Recombinant Mouse Thromboxane A2 receptor (Tbxa2r)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Tbxa2r; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MWPNGTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAIVASQHAALLDWRATDPSCRLCYFMGVAMVFFGLCPLL LGAAMASERFVGITRPFSRPTATSRRAWATVGLVWVAAGALGLLPLLGLGRYSVQYPGSW CFLTLGTQRGDVVFGLIFALLGSASVGLSLLLNTVSVATLCRVYHTREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFIMQTLLQTPPVMSFSGQLLRATEHQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFSSQLQAVSLRRPPAQAMLSGP
Uniprot No.

Target Background

Function
The Thromboxane A2 receptor (TP receptor) is a G protein-coupled receptor that binds Thromboxane A2 (TXA2), a potent platelet aggregation stimulant. The receptor's activity is mediated through a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, TXA2 binding to glomerular TP receptors induces intense vasoconstriction. The receptor activates phospholipase C and adenylyl cyclase.
Gene References Into Functions
  1. Research indicates that EP3, alongside TP, contributes to vasoconstrictor responses triggered by PGI2, suggesting a novel mechanism for endothelial cyclooxygenase metabolites (predominantly PGI2) in regulating vascular functions. PMID: 28165064
  2. Platelet GP6 and thromboxane A2 receptor play a role in promoting an inflammatory macrophage phenotype in skin inflammation. PMID: 27818280
  3. Genetic deletion of the thromboxane receptor in adipose-derived stromal cells accelerated endothelial cell differentiation. PMID: 26957525
  4. PKCalpha deficiency leads to pulmonary vascular hyperresponsiveness to TXA2, potentially due to increased pulmonary arterial TP receptor expression. PMID: 26890419
  5. Uridine adenosine tetraphosphate induced aortic contraction depends on activation of TX synthase and thromboxane A2 receptor, partly requiring the activation of P2X1R through an endothelium-dependent mechanism. PMID: 25921923
  6. The TP receptor is an active participant in the pathogenesis of Alzheimer's disease. PMID: 25457549
  7. Platelet adhesion through thromboxane A receptor signaling facilitates liver repair during acute chemically induced hepatotoxicity. PMID: 25921763
  8. Studies show that the beta1-subunit can form a tripartite complex with TP and MaxiKalpha, demonstrating the ability to associate with each protein independently. PMID: 23255603
  9. Blocking thromboxane receptor expression significantly suppresses the prothrombotic effect of C-reactive protein. PMID: 22879580
  10. The thromboxane A(2) receptor agonist 11-deoxy PGF(2alpha) can partially alleviate embryo crowding in Lpar3((-/-)) females. Embryo crowding is likely a contributing factor to reduced litter size in these females. PMID: 22222195
  11. Research demonstrates that the thromboxane receptor in the striatum locally facilitates dopamine overflow. PMID: 21749493
  12. Thromboxane A2 receptor signaling does not play a critical role in the pathogenesis of ischemic acute kidney injury. PMID: 21449636
  13. Thromboxane A2 receptor activation via PKC-zeta-mediated NAD(P)H oxidase activation increases superoxide and peroxynitrite, resulting in eNOS uncoupling in endothelial cells. PMID: 20947827
  14. Genetic variations exist in this protein in platelet function disorders. PMID: 20162250
  15. Thromboxane synthase, prostacyclin synthase, and thromboxane receptor play roles in atherosclerotic lesions and correlate with plaque composition. PMID: 19735918
  16. TXA2-TP signaling modulates acquired immunity by negatively regulating DC-T cell interactions. PMID: 12778172
  17. Thromboxane A2 (TXA2)-mediated platelet secretion and aggregation are crucial in thrombosis. The stable TXA2 analogue, U46619, induces two waves of platelet secretion, each preceding a distinct wave of platelet aggregation. PMID: 12796499
  18. Activation of TP receptors promotes T cell proliferation and contributes to immune-mediated tissue injury. PMID: 14662837
  19. The thromboxane A2 receptor has a role in the pathogenesis of angiotensin II-dependent hypertension. PMID: 14718360
  20. TP -/- mice exhibit a basal increase in renal vascular resistance and filtration fraction, associated with reactive oxygen species. PMID: 15213069
  21. TXA2 promotes, while PGI2 prevents, the initiation and progression of atherogenesis by controlling platelet activation and leukocyte-endothelial cell interaction in Apolipoprotein e deficient mice. PMID: 15372102
  22. Baseline systolic blood pressure did not differ between TP(-/-) and TP(+/+) mice. PMID: 15635218
  23. Endothelial cells genetically lacking the thromboxane receptor exhibit reduced inflammatory responses when stimulated with isoprostane F2alpha-III but not other oxidized lipids. PMID: 16267259
  24. Endogenous activation of the TXA2 receptor by eicosanoids did not modulate spontaneous neovascularization in the setting of ischemia. PMID: 16385086
  25. Increased responsiveness of thromboxane A(2) receptors occurs in diabetic ApoE-KO mouse kidneys. PMID: 17942572
  26. Blockage of thromboxane receptors provoked embolus formation in wildtype blood. PMID: 18000613
  27. 12/15LO- and TxA(2) receptor-mediated pro-atherogenic effects are two distinct pathways. PMID: 18206890
  28. COX-1 contributes to the enhanced formation of both PGI(2) and TXA(2) in atherosclerosis, and to the development of the disease. PMID: 18514659
  29. In L-NAME hypertension, TP receptors contribute to elevated blood pressure and cardiac hypertrophy. In this model, TP receptors also provided unexpected protection against kidney injury. PMID: 18684890
  30. Research demonstrates that isoprostanes inhibit angiogenesis via activation of the TBXA2R. PMID: 18802021
  31. Thromboxane receptor knockout mice showed normal pain behavior in all tests. PMID: 18938093
  32. The findings from this and previous studies suggest an autocrine loop, involving cyclooxygenase-2, thromboxane A synthase, and thromboxane A2 and its receptor, in cyclooxygenase-2-dependent inhibition of StAR gene expression. PMID: 19325001
  33. Thromboxane A2 receptor stimulation impairs insulin signaling in vascular endothelial cells by selectively activating the Rho/Rho-associated kinase/LKB1/PTEN pathway. PMID: 19403525

Show More

Hide All

Database Links

KEGG: mmu:21390

STRING: 10090.ENSMUSP00000100962

UniGene: Mm.4545

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and localization of mouse Tbxa2r?

Mouse Tbxa2r is a G protein-coupled receptor with an expected protein mass of approximately 37.4 kDa. Immunofluorescence studies reveal that Tbxa2r is predominantly localized on the cytoplasmic membrane, with some distribution in perinuclear compartments of cells. In microglia, for instance, the receptor shows primary localization on the plasma membrane with additional presence in cytosolic perinuclear regions . The protein structure includes typical seven-transmembrane domains characteristic of G protein-coupled receptors, with multiple isoforms reported due to alternative splicing .

What signaling pathways are activated by mouse Tbxa2r?

Mouse Tbxa2r primarily signals through:

  • ERK (Extracellular signal-Regulated Kinase) pathway: Tbxa2r activation induces dose- and time-dependent ERK phosphorylation, particularly important in microglial activation .

  • Rho signaling: Tbxa2r enhances cell migration and invasion by activating Rho signaling, which can be reversed using Rho-associated Kinase (ROCK) inhibitors .

  • ERM (Ezrin-Radixin-Moesin) protein activation: Recent research indicates Tbxa2r activates ERM proteins to regulate cell migration, invasion, and metastatic potential .

Methodologically, these pathways can be studied using phosphorylation-specific antibodies in Western blot analysis, pharmacological inhibitors (MEK inhibitor U0126, ROCK inhibitors), and cellular phenotype assays following receptor activation with specific agonists like U46619 .

How does mouse Tbxa2r expression change under pathological conditions?

Tbxa2r expression shows significant upregulation in various pathological conditions:

  • Ischemic brain injury: Protein levels increase significantly in ipsilateral mouse brain tissue at 24 hours post-ischemia-reperfusion. Western blot quantification reveals substantial upregulation compared to contralateral hemisphere or sham controls .

  • Cancer contexts: Certain cancers show altered expression of Tbxa2r. In breast cancer models, TBXA2R expression correlates with specific subtypes and clinical outcomes .

For quantifying expression changes, researchers should employ:

  • Western blotting with specific antibodies

  • RT-qPCR for transcript level assessment

  • Immunohistochemistry to analyze tissue distribution patterns and co-localization with cell-specific markers (e.g., CD11b for microglia/macrophages in brain tissue)

What factors regulate Tbxa2r transcription and protein stability?

Research indicates several regulatory mechanisms:

  • BRCA1-mediated transcriptional repression: BRCA1 knockdown increases TBXA2R mRNA and promoter activities, with c-Myc being required for this BRCA1-mediated transcriptional repression .

  • Post-translational modifications: Although not fully characterized for mouse Tbxa2r specifically, G protein-coupled receptors typically undergo phosphorylation, ubiquitination, and internalization following ligand binding.

Methodologically, researchers should consider:

  • Promoter-reporter assays to study transcriptional regulation

  • ChIP (Chromatin Immunoprecipitation) to identify transcription factor binding

  • Pulse-chase experiments to assess protein turnover rates

How can mouse Tbxa2r function be effectively studied in neuroinflammation models?

To study Tbxa2r in neuroinflammation:

  • Primary microglia and microglial cell line systems: Use BV2 cells or primary microglia cultures to assess the direct effects of Tbxa2r activation. Treatment with the TP agonist U46619 enhances inflammatory mediator production (IL-1β, IL-6, iNOS) and NO release, which can be quantified by ELISA, qPCR, and Griess assay .

  • Co-culture systems: Employ neuronal-microglial co-culture models (e.g., SH-SY5Y cells with microglia) to assess how Tbxa2r activation in microglia affects neuronal viability and function. Conditioned media experiments reveal that U46619-treated BV2 cells produce factors that decrease neuronal cell viability and induce apoptotic morphological changes .

  • Pharmacological modulation: Use specific agonists (U46619) and antagonists (SQ29548) to manipulate receptor activity, combined with pathway inhibitors (U0126 for MEK/ERK) to delineate downstream signaling .

  • In vivo models: Utilize ischemia-reperfusion models (e.g., transient middle cerebral artery occlusion) to examine Tbxa2r expression changes and function in neuroinflammatory contexts .

What methodologies are most effective for studying Tbxa2r in immune cell function?

To investigate Tbxa2r in immune regulation:

How does mouse Tbxa2r contribute to cancer progression and metastasis?

Evidence supports multiple roles for Tbxa2r in cancer:

  • Cell survival promotion: TBXA2R functions as a survival factor specifically for certain cancer types. Knockdown of TBXA2R causes dramatic cell death in Triple Negative Breast Cancer (TNBC) cells, identifying it as a potential therapeutic target .

  • Migration and invasion: TBXA2R enhances cancer cell migration and invasion through activation of Rho signaling. These phenotypes can be reversed using ROCK inhibitors, suggesting a mechanistic pathway through which TBXA2R promotes metastatic behavior .

  • Protection from DNA damage: TBXA2R protects cancer cells from DNA damage by negatively regulating reactive oxygen species (ROS) levels, potentially contributing to therapy resistance .

  • Metastatic colonization: Recent research indicates TBXA2R activation enhances metastatic colonization in vivo, suggesting its importance in the later stages of cancer progression .

Methodologically, researchers should consider:

  • In vitro migration and invasion assays

  • ROS measurement using fluorescent probes

  • Rho activation assays

  • In vivo metastasis models

What are the optimal approaches for generating and validating recombinant mouse Tbxa2r for functional studies?

When generating recombinant mouse Tbxa2r:

  • Expression systems: Consider mammalian expression systems (HEK293, CHO cells) for proper folding and post-translational modifications of the receptor. These systems more closely recapitulate the native environment compared to bacterial or insect cell systems.

  • Tagging strategies:

    • N-terminal tags may interfere with signal peptide processing

    • C-terminal tags are generally preferred for GPCRs but verify that they don't disrupt G-protein coupling

    • Common tags include FLAG, HA, or His for detection and purification

  • Validation approaches:

    • Binding assays with known ligands (U46619)

    • Functional assays measuring downstream signaling (calcium flux, ERK phosphorylation)

    • Surface expression verification via immunofluorescence or flow cytometry

    • Western blotting to confirm expected molecular weight (approximately 37.4 kDa)

  • Mutagenesis studies: Generate point mutations in key residues to assess structure-function relationships and binding properties

How do mouse and human TBXA2R differ in structure and function?

Understanding species differences is crucial for translational research:

  • Sequence homology: Mouse and human TBXA2R share significant sequence homology, though species-specific differences exist in certain domains that may affect ligand binding and signaling properties.

  • Isoform expression: Both species express multiple isoforms due to alternative splicing, though the relative abundance and tissue distribution of these isoforms may differ .

  • Signaling conservation: Core signaling pathways (ERK activation, Rho signaling) appear conserved between species, suggesting functional similarity despite structural differences .

  • Pharmacological responses: Mouse and human receptors may show differential sensitivity to certain agonists and antagonists, necessitating careful validation when translating findings between species.

When conducting comparative studies, researchers should:

  • Perform sequence alignment analysis

  • Compare pharmacological profiles using dose-response curves

  • Validate antibody cross-reactivity between species

  • Consider species-specific differences in downstream effector coupling

What are the key considerations when using recombinant mouse Tbxa2r models to study human disease?

When translating findings from mouse to human systems:

What are the most reliable detection methods for mouse Tbxa2r in different experimental contexts?

Optimal detection strategies vary by application:

  • Immunodetection approaches:

    • Western blotting: Effective for quantifying total protein levels in tissue or cell lysates

    • Immunofluorescence: Useful for determining subcellular localization (predominantly membrane)

    • Flow cytometry: Appropriate for quantifying surface expression levels in intact cells

    • Immunohistochemistry: Valuable for tissue distribution analysis and co-localization studies

  • Transcript analysis:

    • RT-qPCR: Provides sensitive quantification of mRNA expression

    • RNA-Seq: Offers comprehensive transcriptomic analysis including isoform detection

    • In situ hybridization: Allows visualization of transcript localization in tissue sections

  • Functional detection:

    • Calcium flux assays: Measure receptor activation in live cells

    • ERK phosphorylation: Downstream readout of receptor activation

    • Rho activation assays: Assess pathway-specific activation

How can researchers effectively modulate mouse Tbxa2r activity in experimental systems?

Multiple approaches are available:

  • Pharmacological modulation:

    • Agonists: U46619 is a commonly used TP agonist for receptor activation

    • Antagonists: SQ29548 effectively blocks TP signaling

    • Pathway inhibitors: U0126 (MEK/ERK inhibition) and ROCK inhibitors can block downstream effects

  • Genetic approaches:

    • siRNA/shRNA: For transient or stable knockdown

    • CRISPR-Cas9: For complete knockout or precise mutations

    • Overexpression systems: For gain-of-function studies

  • Experimental design considerations:

    • Timing: Acute versus chronic modulation may yield different outcomes

    • Dose-response: Establish full dose-response curves rather than single concentrations

    • Specificity controls: Include receptor-negative cells to confirm specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.