Recombinant Mouse Thyrotropin-releasing hormone receptor (Trhr)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The thyrotropin-releasing hormone receptor (Trhr) is a G protein-coupled receptor (GPCR) that binds thyrotropin-releasing hormone (TRH), a key regulator of the hypothalamic-pituitary-thyroid axis. Recombinant mouse Trhr is synthesized in vitro to study its structure, ligand interactions, and downstream signaling mechanisms .

Production and Purification

The protein is produced in heterologous expression systems such as E. coli, mammalian cells, or baculovirus-infected insect cells.

Expression Systems Comparison

SystemAdvantagesPurityYield
E. coliCost-effective, rapid production≥85% High
Mammalian CellsProper glycosylation, functional folding>90% Moderate
BaculovirusSuitable for large-scale production≥85% High
  • Formulation: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) .

  • Reconstitution: Recommended in sterile PBS at 0.1–1.0 mg/mL, with glycerol for long-term storage .

Biochemical and Functional Properties

  • Ligand Binding: Binds TRH with high affinity, activating Gq/11 proteins to stimulate phospholipase C (PLC) and increase intracellular calcium .

  • Signaling Pathways:

    • Calcium Signaling: Mediates hormone secretion via IP3-dependent calcium release .

    • Neuroactive Ligand-Receptor Interaction: Modulates thyrotropin (TSH) and prolactin release in the pituitary .

Key Studies Utilizing Recombinant Trhr

  • In Vitro Transcription Assays: Demonstrated TRH-dependent activation of adenylate cyclase and cAMP production using recombinant receptors .

  • Knockout Mouse Models: TRH receptor-deficient mice (e.g., TRH-R1⁻/⁻) exhibit hypothyroidism and impaired glucose homeostasis, highlighting Trhr's metabolic roles .

  • Structural Studies: Used to map ligand-binding domains and GPCR activation mechanisms .

Comparative Analysis of Available Recombinant Trhr Proteins

SupplierHostTagPurityApplications
Creative BioMart E. coliHis>90%SDS-PAGE, binding assays
MyBioSource Mammalian CellsNone≥85%Functional studies
R&D Systems Insect CellsFc≥85%Neutralization assays

Key Research Findings

  • Hyperglycemia Link: TRH⁻/⁻ mice showed elevated fasting glucose levels due to impaired insulin secretion, independent of thyroid status .

  • Behavioral Phenotypes: TRH-R2⁻/⁻ mice exhibited anxiety-like behaviors, suggesting extrahypothalamic Trhr roles in mood regulation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage state, buffer ingredients, storage temperature and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please communicate it to us. We will prioritize developing the specified tag if feasible.
Synonyms
Trhr; Thyrotropin-releasing hormone receptor; TRH-R; Thyroliberin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MENDTVSEMNQTELQPQAAVALEYQVVTILLVVIICGLGIVGNIMVVLVVMRTKHMRTPT NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKNAVVVSCG YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKMWKNDSIH QNKNLNLNATNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES DRFSTELEDITVTDTYVSTTKVSFDDTCLASEN
Uniprot No.

Target Background

Function
Thyrotropin-releasing hormone receptor (TRH-R1) is a G-protein-coupled receptor that binds to thyrotropin-releasing hormone (TRH). Upon ligand binding, this receptor activates the phosphatidylinositol (IP3)-calcium-protein kinase C (PKC) signaling pathway.
Gene References Into Functions
  1. Activating TRH/TRH-R1 signaling alone may not be sufficient to stimulate gastric production of acylated ghrelin. PMID: 25490146
  2. The central nervous system effects of taltirelin are primarily mediated by TRH-R1 rather than TRH-R2. PMID: 23303050
  3. Our findings suggest that sustained signaling by TRHRs occurs when sufficient levels of agonist/receptor/G-protein complexes are established and maintained. TRH-R2 appears to form and maintain these complexes more efficiently than TRH-R1. PMID: 22593547
  4. Three distinct and discontinuous regions of the TSHR (amino acids 246-260 and 277-296 on the TSHR A subunit) and amino acids 381-385 (on the TSHR B subunit) fold together to create a complex TSH binding pocket. PMID: 12593718
  5. The TSHR may not conform to the characteristics of other model proteins used to define the concept of central immune tolerance. PMID: 14630711
  6. TRH-R1 plays a role in mouse lactation, and mice lacking this receptor exhibit signs of central hypothyroidism. PMID: 14988432
  7. Thyrotropin-releasing hormone binding induces separation of the cytoplasmic ends of TRH receptor type 1 transmembrane helix 5 (TMH5) and TMH6, as well as a rotation of TMH6. This could facilitate interactions between G proteins and key residues within the TRH receptor. PMID: 15709754
  8. Beta-arrestin participates in desensitization and internalization, but not phosphorylation, of the thyrotropin-releasing hormone receptor. This leads to translocation of endogenous GRK2 to the plasma membrane. PMID: 16183993
  9. The endogenous TRH system is involved in mood regulation, and this function is mediated by TRH-R1-dependent neural pathways. PMID: 17666589
  10. Flexible molecular docking analysis revealed that TRH establishes a direct interaction with tryptophan at position 6.48 in TRH-R2 but not in TRH-R1. PMID: 17979196
  11. Direct TRH receptor-mediated excitation of histaminergic tuberomamillary neurons by thyrotropin-releasing hormone requires activation of nonselective cation channels, as well as electrogenic sodium/divalent calcium ion exchange. PMID: 19357273

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Thyrotropin-releasing hormone receptor (Trhr) and what is its role in mice?

Thyrotropin-releasing hormone receptor (Trhr) belongs to the G protein-coupled receptor (GPCR) family, functioning in a similar signaling pathway as the thyrotropin (TSH) receptor. In mice, Trhr is predominantly expressed in the anterior pituitary where it binds thyrotropin-releasing hormone (TRH) produced by the hypothalamus. This receptor-ligand interaction initiates signaling cascades primarily through the Gq/11 pathway, activating phospholipase C, generating inositol trisphosphate and diacylglycerol, and ultimately triggering calcium mobilization and protein kinase C activation.

The primary physiological functions of Trhr in mice include regulation of thyroid-stimulating hormone (TSH) synthesis and secretion, control of prolactin release, modulation of growth hormone production, and involvement in certain central nervous system processes. The Trhr signaling system is integral to maintaining proper thyroid hormone levels, which are essential for normal development, metabolism, and physiological homeostasis.

Similar to TSHR, which has been more extensively studied, Trhr plays a crucial role in the hypothalamic-pituitary-thyroid axis. As demonstrated in TSHR knockout mouse studies, disruption of this signaling pathway can lead to profound thyroid dysfunction . While Trhr operates upstream in this pathway, its functional significance parallels that of TSHR in maintaining thyroid hormone homeostasis.

How are recombinant mouse Trhr proteins produced for research purposes?

Production of recombinant mouse Trhr proteins for research involves several critical steps and considerations:

  • Gene acquisition and vector design: The mouse Trhr gene is either cloned from genomic DNA/cDNA libraries or synthesized based on its published sequence. The gene is inserted into an expression vector containing appropriate regulatory elements, purification tags (commonly His, FLAG, or GST tags), and selection markers.

  • Expression system selection: Due to Trhr's nature as a multi-pass membrane protein with complex folding requirements, mammalian expression systems are typically preferred. Common options include:

    • HEK293 or CHO cells: Provide proper post-translational modifications

    • Insect cell systems (Sf9, High Five): Offer high yields with appropriate folding

    • Cell-free systems: For small-scale production with rapid turnaround

  • Optimization of expression conditions: Parameters including cell density, transfection method, induction timing, expression duration, and temperature require optimization to maximize functional protein yields while minimizing misfolded products.

  • Membrane extraction and solubilization: Carefully selected detergents (often DDM, LMNG, or digitonin) are used to extract Trhr from cellular membranes while preserving its native conformation and function.

  • Purification strategy: Typically involves:

    • Affinity chromatography using the engineered tag

    • Size exclusion chromatography to separate monomeric receptor from aggregates

    • Ion exchange chromatography for further purification if needed

  • Quality control assessment: The purified protein undergoes functional validation through:

    • Ligand binding assays to confirm activity

    • Western blotting for purity assessment

    • Circular dichroism for secondary structure analysis

    • Thermal stability assays to assess proper folding

The methodological approaches for producing recombinant Trhr share similarities with techniques used for other membrane proteins, including TSHR as referenced in studies of thyroid receptor function . The production process requires careful attention to maintaining the protein's native conformation and functional properties throughout the isolation and purification steps.

What are the key experimental models available for studying Trhr function?

Researchers have developed multiple experimental models for investigating Trhr function, each offering specific advantages for different research questions:

  • Cell-based systems:

    • Heterologous expression systems: HEK293 or CHO cells transiently or stably expressing mouse Trhr

    • Pituitary cell lines: Mouse AtT-20 or rat GH3 cells with endogenous Trhr expression

    • Primary pituitary cell cultures: Offering physiologically relevant expression levels and signaling machinery

  • Genetic mouse models:

    • Conventional Trhr knockout mice: Complete deletion of receptor function

    • Conditional knockouts: Allowing tissue-specific or temporally controlled deletion

    • Knock-in models: Introducing reporter genes, mutations, or human variants

    • Transgenic overexpression: For studying effects of increased receptor density

  • Tissue preparations:

    • Pituitary explant cultures: Maintaining cellular architecture and paracrine interactions

    • Brain slice preparations: For studying central Trhr functions

    • Membrane preparations: For biochemical and pharmacological studies

  • In silico approaches:

    • Homology models based on related GPCR structures

    • Molecular dynamics simulations of receptor-ligand interactions

    • Systems biology models of hypothalamic-pituitary-thyroid feedback loops

These models can be used in complementary fashion to address different aspects of Trhr biology. For example, cell systems provide controlled environments for detailed signaling studies, while knockout models reveal physiological roles in whole organisms. The approach to generating Trhr genetic models would follow methodologies similar to those described for other receptor systems, such as the TSHR knockout mice that showed developmental delays and hypothyroidism or the transgenic approaches used for nicotinic receptor studies .

Model TypeAdvantagesLimitationsBest Applications
Cell linesControlled environment, ease of manipulationLack physiological contextSignaling mechanisms, drug screening
Knockout miceWhole-organism physiological relevanceDevelopmental compensationSystemic receptor function
Conditional knockoutsTemporal/spatial specificityTechnical complexityTissue-specific functions
Primary culturesNative expression levelsShort lifespan, variabilityPhysiological signaling studies

What methods are most effective for detecting Trhr expression in tissue samples?

Detection of Trhr expression in tissue samples requires specialized techniques due to its typically low endogenous expression levels. The most effective approaches include:

  • mRNA detection methods:

    • Quantitative RT-PCR: Offers high sensitivity for detecting Trhr transcripts using carefully validated primer sets targeting conserved regions

    • In situ hybridization: Visualizes spatial expression patterns within intact tissue architecture

    • RNAscope: Provides single-molecule detection sensitivity with improved signal-to-noise ratio

    • RNA-Seq: Enables comprehensive transcriptomic profiling and detection of splice variants

  • Protein detection methods:

    • Immunohistochemistry/Immunofluorescence: Requires carefully validated antibodies with confirmed specificity

    • Western blotting: Often requires membrane enrichment steps due to low expression

    • Radioligand binding: Quantifies functional receptor density using selective ligands

    • Mass spectrometry: For unambiguous identification and potential quantification

  • Reporter systems:

    • Knock-in mice expressing fluorescent proteins under Trhr promoter control

    • Trhr-promoter driven reporter constructs in cell systems

    • CRISPR-mediated tagging of endogenous receptor

For reliable results, several methodological considerations are critical:

  • Positive and negative controls should always be included (e.g., pituitary tissue as positive control)

  • Validation with multiple independent detection methods is recommended

  • Careful tissue preparation to preserve receptor integrity (rapid fixation or flash-freezing)

  • Inclusion of competing peptides or knockout tissues for antibody validation

The detection approach should be tailored to the experimental question. For example, expression studies examining regulatory mechanisms would benefit from qRT-PCR and in situ hybridization, while studies of receptor trafficking would require immunofluorescence or tagged receptor systems. The principle of using multiple complementary techniques is similar to the approach used in TSHR studies, where both functional assays and expression analysis were employed .

How does mouse Trhr differ from human Trhr and what are the implications for translational research?

Mouse and human Thyrotropin-releasing hormone receptors exhibit significant differences that must be considered when translating research findings:

These differences have important implications for translational research:

  • Pharmacological tools optimized for mouse Trhr may show altered properties with human receptors

  • Mouse models may not fully recapitulate human thyroid physiology or pathology

  • Drug discovery efforts require testing on both species' receptors

  • Genetic findings in mice should be validated in human systems

To address these challenges, researchers often employ comparative studies using both receptors, humanized mouse models, or parallel studies in human and mouse systems. This species-specific approach is similar to considerations required for other receptor systems, including the related TSHR, where species differences also affect research translation .

What considerations are important when designing Trhr knockout mouse models?

Designing effective Trhr knockout mouse models requires careful planning to ensure meaningful results while minimizing confounding factors:

  • Targeting strategy selection:

    • Complete vs. conditional knockout approaches

    • Selection of critical exons encoding transmembrane domains for targeting

    • Consideration of potential alternative splicing creating functional fragments

    • Inclusion of reporter genes to track expression patterns

  • Background strain considerations:

    • C57BL/6: Most common background with extensive baseline data

    • 129/Sv: Historically used for embryonic stem cell manipulation

    • Mixed backgrounds: Consider genetic heterogeneity effects

    • Congenic strains: Require extensive backcrossing but provide genetic uniformity

  • Control design:

    • Littermate controls to minimize environmental and maternal effects

    • Heterozygotes to assess gene dosage effects

    • Floxed but unrecombined controls for conditional models

    • Wild-type controls from the same colony for environmental consistency

  • Phenotypic assessment planning:

    • Comprehensive physiological profiling (thyroid hormones, metabolic parameters)

    • Developmental milestones monitoring

    • Behavioral testing if CNS functions are of interest

    • Sensitivity to environmental challenges (cold exposure, fasting)

    • Tissue-specific changes in the pituitary-thyroid axis

  • Potential confounding factors:

    • Developmental compensation (upregulation of related pathways)

    • Strain-specific modifiers affecting phenotype penetrance

    • Maternal effects if breeding homozygous knockouts is challenging

    • Thyroid hormone supplementation needs if severe hypothyroidism develops

  • Genotyping strategy:

    • Design of reliable PCR-based methods to distinguish genotypes

    • Inclusion of positive and negative controls in each genotyping run

    • Alternative validation methods (Southern blotting) for founder characterization

When characterizing Trhr knockout mice, researchers should anticipate phenotypes related to the hypothalamic-pituitary-thyroid axis. Studies of TSHR knockout mice demonstrated "developmental and growth delays and were profoundly hypothyroid, with no detectable thyroid hormone and elevated TSH" . While Trhr knockouts would have distinct phenotypes, the methodological approach to characterization would be similar, examining growth, development, fertility, and detailed thyroid function.

How can researchers effectively study Trhr trafficking and internalization dynamics?

Investigating Trhr trafficking and internalization requires specialized techniques to capture the spatial and temporal aspects of receptor movement:

  • Live-cell imaging approaches:

    • Fluorescent protein tagging (GFP, mCherry) of Trhr for real-time visualization

    • pH-sensitive fluorophores (pHluorin) to distinguish surface from internalized receptors

    • Pulse-chase labeling with SNAP/CLIP/Halo-tagged receptors for temporal resolution

    • Quantum dot labeling for single-particle tracking at the cell surface

    • TIRF microscopy for selective visualization of plasma membrane events

  • Quantitative endocytosis assays:

    • Cell surface ELISA using epitope-tagged receptors

    • Flow cytometry with antibodies targeting extracellular epitopes

    • Biotin labeling of surface proteins followed by internalization assessment

    • Radioligand binding to measure surface receptor density over time

    • Bioluminescence resonance energy transfer (BRET) assays for protein-protein interactions during trafficking

  • Molecular and cellular tools:

    • Dominant-negative mutants of endocytic machinery components

    • siRNA/shRNA knockdown of trafficking regulators

    • Small molecule inhibitors of specific endocytic pathways

    • Temperature manipulation to block specific trafficking steps

    • Compartment-specific markers for colocalization studies

  • Advanced analytical methods:

    • Automated tracking algorithms for vesicular movement

    • Mean square displacement analysis for diffusion characteristics

    • Quantitative colocalization with markers of specific compartments

    • Mathematical modeling of receptor recycling kinetics

    • Fluorescence recovery after photobleaching (FRAP) for membrane mobility

  • Experimental design considerations:

    • Stable vs. transient expression systems

    • Physiological vs. overexpression levels

    • Agonist concentration and exposure time

    • Cell type selection (native vs. heterologous)

    • Temperature control for physiological trafficking rates

These approaches can reveal important aspects of Trhr regulation, including internalization rates, recycling efficiency, and degradation pathways in response to different stimuli. The trafficking patterns may also provide insights into signaling persistence and desensitization mechanisms. Similar approaches have been applied to other GPCRs, including methodologies that could be adapted from TSHR research, where receptor dynamics contribute significantly to thyroid function regulation .

What molecular dynamic simulation approaches can be applied to study Trhr structure-function relationships?

Molecular dynamics (MD) simulations offer powerful tools for investigating Trhr structure-function relationships at atomic resolution, similar to approaches used for related receptors:

  • Model construction methodologies:

    • Homology modeling based on crystallized GPCR structures

    • Integration of experimental constraints from mutagenesis studies

    • Ab initio modeling of unique domains lacking homologous templates

    • Artificial intelligence approaches (AlphaFold2) for structure prediction

    • Refinement using experimental data from HDX-MS or crosslinking studies

  • Simulation system preparation:

    • Embedding in lipid bilayer membranes (POPC, POPE/POPG mixtures)

    • Solvation with explicit water molecules and physiological ion concentrations

    • Inclusion of bound ligands, G proteins, or other interacting partners

    • Assignment of appropriate force fields (CHARMM36, AMBER)

    • System equilibration and energy minimization protocols

  • Simulation approaches:

    • All-atom simulations for detailed conformational analysis

    • Coarse-grained methods for longer timescale events

    • Enhanced sampling techniques (metadynamics, replica exchange)

    • Targeted molecular dynamics to study conformational transitions

    • Multi-scale modeling combining quantum and molecular mechanics

  • Analysis methodologies:

    • Conformational clustering and principal component analysis

    • Identification of key water-mediated networks

    • Characterization of sodium and lipid binding sites

    • Analysis of correlated motions within the receptor

    • Calculation of free energy landscapes for conformational states

  • Applications to specific research questions:

    • Ligand binding mode prediction and binding affinity estimation

    • Allosteric communication pathways throughout the receptor

    • Conformational changes during receptor activation

    • Species differences in receptor structure and dynamics

    • Effects of mutations on receptor stability and function

Following approaches similar to those described for TSHR modeling in search result , comprehensive MD simulations of Trhr would involve "a 1000 ns molecular dynamic simulation on a model of the entire [receptor] generated by merging the extracellular region of the receptor, obtained using artificial intelligence, with [a] recent homology model of the transmembrane domain, embedded it in a lipid membrane and solvated it with water and counterions." Such simulations can reveal insights about receptor flexibility, ligand interactions, and conformational changes that are difficult to observe experimentally.

How do post-translational modifications regulate mouse Trhr function?

Post-translational modifications (PTMs) significantly influence Trhr function through multiple mechanisms:

  • N-linked glycosylation:

    • Occurs at asparagine residues within N-X-S/T consensus sequences in the N-terminal domain

    • Critical for proper receptor folding and trafficking to the cell surface

    • Influences ligand binding affinity and specificity

    • Protects against proteolytic degradation

    • Can be studied using site-directed mutagenesis, tunicamycin treatment, or enzymatic deglycosylation

  • Palmitoylation:

    • Occurs at conserved cysteine residues in the C-terminal tail

    • Modulates receptor localization in membrane microdomains

    • Regulates G protein coupling efficiency and receptor stability

    • Affects receptor internalization kinetics

    • Can be analyzed using metabolic labeling with palmitate analogs and mass spectrometry

  • Phosphorylation:

    • Mediated by GRKs, PKA, and PKC at serine/threonine residues in intracellular loops and C-terminus

    • Initiates desensitization by promoting β-arrestin recruitment

    • Controls internalization rate and post-endocytic sorting

    • Creates signaling bias by differentially affecting pathway activation

    • Studied using phosphosite-specific antibodies, mass spectrometry, and phosphomimetic mutations

  • Ubiquitination:

    • Targets lysine residues primarily in the intracellular domains

    • Regulates receptor degradation vs. recycling decisions

    • Mono- vs. poly-ubiquitination leads to different trafficking outcomes

    • Can be investigated using ubiquitin mutants and proteasome/lysosome inhibitors

  • Methodological approaches for studying PTMs:

    • Mass spectrometry for comprehensive PTM identification

    • Site-directed mutagenesis of modified residues

    • Inhibitors of specific modifying enzymes

    • Antibodies against specific modifications

    • Correlation of modification patterns with functional outcomes

The dynamic nature of these modifications creates a complex regulatory system that fine-tunes receptor function in different physiological contexts. For example, hormone-induced phosphorylation patterns may differ from constitutive modifications, leading to distinct functional outcomes. Understanding these patterns requires temporal profiling of modifications following receptor activation, similar to approaches used in studies of related receptors like TSHR .

What techniques are most effective for studying Trhr-G protein coupling selectivity?

Investigating Trhr coupling preferences to different G protein subtypes requires specialized approaches:

  • Cell-based functional assays:

    • Second messenger measurements (IP3, Ca²⁺, cAMP) for primary G protein pathways

    • BRET/FRET-based sensors for real-time G protein activation monitoring

    • G protein-specific biosensors for pathway-selective detection

    • Electrical impedance measurements for integrated cellular responses

    • Specific G protein inhibitors (pertussis toxin, YM-254890) to isolate pathways

  • Biochemical coupling assays:

    • [³⁵S]GTPγS binding assays with immunoprecipitation of specific G proteins

    • G protein competition binding with purified components

    • Co-immunoprecipitation of receptor-G protein complexes

    • Crosslinking of receptor-G protein pairs followed by mass spectrometry

    • Reconstitution of purified components in artificial membranes

  • Structural and biophysical approaches:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

    • Site-directed fluorescence spectroscopy to detect conformational changes

    • Electron paramagnetic resonance for distance measurements

    • Single-molecule FRET to capture coupling dynamics

    • Cryo-EM of stabilized receptor-G protein complexes

  • Genetic and molecular tools:

    • CRISPR knockout/knockdown of specific G proteins

    • G protein chimeras to map coupling determinants

    • Receptor mutations in G protein interface regions

    • Mini-G proteins as soluble surrogates for specific G subtypes

    • BiFC complementation to visualize specific interactions

  • Data analysis approaches:

    • Operational models of agonism for quantifying bias

    • Kinetic analysis of G protein activation rates

    • Concentration-response curves with multiple readouts

    • Correlation of structural features with coupling preferences

    • Network analysis of pathway integration

These techniques can reveal important aspects of Trhr signaling specificity, including potential biased agonism (where different ligands preferentially activate distinct pathways) and cell type-specific coupling patterns. The coupling mechanisms of Trhr likely share similarities with those of TSHR, which primarily couples to the Gs pathway to stimulate adenylate cyclase, as evidenced by the ability of forskolin (an adenylate cyclase activator) to restore certain functions in TSHR knockout mice .

What are the challenges in developing selective agonists/antagonists for mouse Trhr?

Developing selective pharmacological tools for mouse Trhr presents several significant challenges:

  • Structural barriers:

    • Limited high-resolution structural data for mouse Trhr

    • Highly conserved orthosteric binding pocket among related receptors

    • Conformational flexibility of the receptor binding domains

    • Species differences between mouse and human receptors

    • Challenges in capturing the inactive state for antagonist design

  • Selectivity challenges:

    • Cross-reactivity with related peptide receptors

    • Achieving selectivity while maintaining potency

    • Differentiating between potential receptor subtypes

    • Designing ligands with specific signaling bias profiles

    • Species selectivity considerations for translational studies

  • Pharmacokinetic obstacles:

    • Peptide stability in biological fluids

    • Blood-brain barrier penetration for CNS studies

    • Oral bioavailability limitations

    • Achieving appropriate half-life for different experimental protocols

    • Distribution to relevant tissues containing Trhr

  • Methodological strategies:

    • Structure-based drug design utilizing homology models

    • High-throughput screening of diverse compound libraries

    • Fragment-based approaches starting with small binding elements

    • Peptide modification strategies (cyclization, N-methylation, etc.)

    • Allosteric modulator development targeting less conserved sites

  • Validation requirements:

    • Comprehensive binding profile against related receptors

    • Functional selectivity assessment across multiple pathways

    • In vitro to in vivo translation evaluation

    • PK/PD relationship characterization

    • Off-target screening against unrelated targets

These challenges necessitate a multifaceted approach combining computational modeling, medicinal chemistry, and extensive pharmacological profiling. The development process typically requires multiple iterations of design, synthesis, and testing to achieve compounds with the desired selectivity profile. Computational approaches similar to those described for modeling the TSHR-ligand complex could be valuable: "preliminary data simulating the full TSHR model complexed with its ligand (TSH) showed that (a) there is a strong affinity between the LR and TSH ligand and (b) the association of the LR and the TSH ligand reduces the structural fluctuations in the LR" . Such insights could guide the development of selective Trhr ligands.

How can researchers effectively study Trhr dimerization and oligomerization?

Investigating Trhr dimerization and oligomerization requires sophisticated techniques that can detect and characterize these molecular assemblies:

  • Biochemical approaches:

    • Cross-linking with membrane-permeable or photoactivatable reagents

    • Co-immunoprecipitation of differentially tagged receptor constructs

    • Blue native PAGE for preserving native protein complexes

    • Perfluorooctanoic acid (PFO)-PAGE for membrane protein complexes

    • Sucrose density gradient centrifugation for size-based separation

  • Resonance energy transfer techniques:

    • FRET between fluorescently labeled receptors

    • BRET using luciferase-tagged receptors

    • Time-resolved FRET for improved sensitivity

    • homo-FRET and anisotropy measurements

    • FRET imaging for spatial resolution of dimerization

  • Advanced microscopy methods:

    • Single-molecule imaging to detect receptor stoichiometry

    • Fluorescence correlation spectroscopy for mobility and complex size

    • Number and brightness analysis for oligomerization state

    • Photoactivated localization microscopy (PALM) for nanoscale distribution

    • Spatial intensity distribution analysis for quantifying complexes

  • Functional approaches:

    • Complementation assays (split luciferase, BiFC)

    • Trans-complementation of function-deficient mutants

    • Dominant-negative approaches with signaling-deficient constructs

    • Bivalent ligands targeting receptor dimers

    • Allosteric modulation between receptor protomers

  • Computational methods:

    • Molecular dynamics simulations of dimer interfaces

    • Protein-protein docking to predict interaction surfaces

    • Analysis of evolutionarily conserved interface residues

    • Molecular modeling of transmembrane helix interactions

    • Simulations of dimer stability in membrane environments

  • Critical experimental controls:

    • Expression level validation to avoid overexpression artifacts

    • Membrane protein controls to rule out non-specific clustering

    • Monomeric and obligate dimeric controls

    • Negative controls using receptor subtypes known not to interact

    • Validation in native tissues or physiological expression systems

These approaches can reveal important aspects of Trhr quaternary structure, including the specific interfaces involved, the effect of ligand binding on oligomerization, and the functional consequences of receptor assembly. The molecular dynamics simulation approaches described for TSHR in search result could be adapted to study potential Trhr dimer interfaces and stability, providing structural insights to complement experimental findings.

How does alternative splicing affect mouse Trhr function and signaling properties?

Alternative splicing generates multiple Trhr variants with distinct functional properties, creating diversity in signaling outcomes:

  • Known Trhr splice variants in mice:

    • Long form: Contains the complete N-terminal domain and all transmembrane segments

    • Truncated forms: Missing specific transmembrane domains

    • N-terminal variants: Alternative first exons affecting signal peptide or ligand binding domains

    • C-terminal variants: Altered intracellular regions affecting G protein coupling

  • Functional consequences of alternative splicing:

    • Modified ligand binding specificity and affinity

    • Altered G protein coupling preferences

    • Different β-arrestin recruitment patterns

    • Unique internalization and trafficking properties

    • Potential dominant-negative effects on signaling

  • Tissue-specific expression patterns:

    • Pituitary-specific expression of certain variants

    • CNS-specific isoform distribution

    • Developmental regulation of splice variant expression

    • Disease-state alterations in splicing patterns

  • Methods for studying splice variants:

    • RT-PCR with isoform-specific primers

    • RNA-Seq for comprehensive transcript analysis

    • Exon junction microarrays

    • Minigene constructs to study splicing regulation

    • Isoform-specific antibodies for protein detection

  • Approaches to functional characterization:

    • Selective expression of individual variants in cell models

    • Creation of isoform-specific knockout models

    • Co-expression studies to detect interactions between variants

    • Isoform-selective pharmacological tools

    • Signaling pathway analysis for each variant

  • Regulatory mechanisms controlling alternative splicing:

    • Tissue-specific splicing factors

    • Hormonal regulation of splicing machinery

    • Pathological alterations in splicing regulation

    • Developmental switches in splicing patterns

The approach to studying Trhr splice variants would share methodological similarities with studies of other receptor systems, potentially employing techniques used to investigate TSHR variants. Understanding the functional significance of these variants requires a combination of expression analysis in native tissues and detailed characterization of their signaling properties when expressed in controlled cellular systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.