Recombinant Mouse TLC domain-containing protein 2 (Tlcd2)

What is the basic structure of mouse Tlcd2 protein?

Mouse TLC domain-containing protein 2 (Tlcd2) is a full-length protein consisting of 310 amino acids. The protein contains a TLC (TRAM, LAG1, and CLN8) domain that is evolutionarily conserved. The amino acid sequence indicates it is a membrane protein with multiple transmembrane domains, consistent with its role in lipid metabolism. The complete amino acid sequence is: MASWGLLVAGASFTAFRGLHWGLQLLPTPKSVRDRWMWRNIFVSLIHSLLSGVGALVGLWQFPQMVTDPINDHPPWARVLVAVSVGYFAADGVDMLWNQTLAQAWDLLCHHLAVVSCLSTAVVSGHYVGFSMVSLLLELNSICLHLRKLLLLSHKAPSLAFRVSSWASLATLVLFRLLPLGWMSLWLSRQHYQLSLALVLLCVAGLVTVGSISISTGIRILTKDILQSQPYPFILMHKETKTREPVARNTSTLSLKGSRYLYSTAAAALGGHLMVLASPKRCMTPSVLGLQERRLEPGKVAHADNASTWE .

What is the primary biological function of Tlcd2?

Tlcd2, along with its family member Tlcd1, functions as a key regulator of cellular phosphatidylethanolamine (PE) composition. Specifically, these proteins promote the incorporation of monounsaturated fatty acids (MUFAs) into PE molecules. Research with knockout models demonstrates that Tlcd1/2 act cell-intrinsically to influence PE fatty acid composition. They interact with mitochondria in an evolutionarily conserved manner and regulate mitochondrial PE composition, which has significant implications for cellular metabolism, oxidative stress, and inflammation processes .

How should recombinant mouse Tlcd2 protein be stored and reconstituted for experimental use?

Recombinant mouse Tlcd2 protein is typically supplied as a lyophilized powder and should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles. Prior to opening, the vial should be briefly centrifuged to bring contents to the bottom. For reconstitution, researchers should use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is typically 50%. Storage at 4°C is suitable for working aliquots for up to one week .

What expression systems are suitable for producing recombinant mouse Tlcd2?

Recombinant mouse Tlcd2 protein has been successfully expressed in E. coli expression systems. The full-length mouse Tlcd2 protein (amino acids 1-310) can be expressed with an N-terminal His tag to facilitate purification. The resulting protein maintains its structural integrity and can be used for various research applications. When designing expression constructs, researchers should consider codon optimization for the host system and appropriate fusion tags that do not interfere with protein folding or function .

How can researchers effectively study Tlcd2 function in cellular systems?

To study Tlcd2 function, researchers can employ several complementary approaches:

• Genetic manipulation: Generate TLCD1/2 knockout cell lines using CRISPR-Cas9 technology, as demonstrated in human hepatocellular carcinoma lines.

• Lipidomic analysis: Compare PE species composition between wild-type and Tlcd2-deficient cells using mass spectrometry.

• Mitochondrial isolation: Examine PE composition specifically in mitochondrial fractions to understand organelle-specific effects.

• Radiotracing: Use radiolabeled fatty acids to track incorporation into PE species.

• Protein-protein interaction studies: Identify binding partners using co-immunoprecipitation or proximity labeling methods.

These approaches have revealed that TLCD1/2 function is conserved between mouse and human cells, with knockout systems showing reduced levels of MUFA-containing PE species and increased saturated fatty acid (SFA)-containing PEs .

What are the best methods for analyzing PE composition changes in Tlcd2 research?

Analyzing PE composition changes in Tlcd2 research requires sophisticated lipidomic approaches. Researchers should consider:

• Sample preparation: Careful extraction of lipids from tissues or cells using appropriate solvent systems that preserve PE species.

• Analytical platforms: Liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS) provides high sensitivity and specificity for identifying and quantifying individual PE molecular species.

• Data analysis: Specialized software for processing complex lipidomic datasets, including normalization strategies and statistical approaches for handling multiple comparisons.

• Validation: Complementary techniques such as thin-layer chromatography or targeted MS approaches to confirm key findings.

• Controls: Including appropriate internal standards and biological controls, such as comparing results across multiple tissues or cell types.

Studies have employed these techniques to demonstrate that Tlcd1/2 specifically affect MUFA-containing PE species while having minimal effects on other phospholipid classes .

How do Tlcd1 and Tlcd2 double-knockout (DKO) mice differ from wild-type in terms of PE metabolism?

Tlcd1/2 double-knockout (DKO) mice exhibit significant alterations in PE metabolism compared to wild-type controls. Key differences include:

• Reduced MUFA-containing PE species: Hepatic levels of monounsaturated fatty acid-containing PE species are significantly lower in DKO mice.

• Altered fatty acid positioning: The changes specifically affect incorporation of MUFAs into the sn-1 position of PE molecules.

• Post-transcriptional mechanism: These alterations occur without changes in the hepatic transcriptome, suggesting a direct biochemical mechanism rather than altered gene expression.

• Consistent phenotype across tissues: Similar PE composition changes are observed in multiple tissues, including red blood cells, which lack transcriptional machinery, further supporting a post-transcriptional mechanism.

• Conserved function: The regulatory role of TLCD1/2 in PE composition is evolutionarily conserved, as similar changes are observed in human cell models .

What is the relationship between Tlcd2 function and metabolic disease?

Tlcd2, together with Tlcd1, plays a significant role in metabolic disease progression, particularly non-alcoholic fatty liver disease (NAFLD). Key relationships include:

• Protection against NAFLD progression: Tlcd1/2 DKO mice show attenuated development of non-alcoholic steatohepatitis compared to controls when challenged with high-fat diets.

• Reduced liver damage: When fed a Western diet (WD), Tlcd1/2 DKO mice exhibit reduced liver size, decreased hepatic inflammation and fibrosis, and lower serum ALT levels (a marker of liver damage) compared to wild-type controls.

• Mitochondrial function: The altered mitochondrial PE composition in Tlcd1/2 DKO mice likely affects mitochondrial function, which is critical in the pathogenesis of metabolic diseases.

• Metabolic parameters: Despite these liver-specific improvements, Tlcd1/2 deficiency does not significantly affect body weight gain, body composition, or glucose tolerance in diet-induced obesity models.

• Downregulation of lipogenic pathways: Transcriptomic analysis reveals downregulation of de novo lipogenesis (DNL) regulatory pathways in Tlcd1/2 DKO mice fed a high-fat diet .

What is known about the interaction between Tlcd2 and long non-coding RNA lnc-TLCD2-1 in cancer research?

Research has identified a long non-coding RNA called lnc-TLCD2-1 that appears to play a role in cancer biology, particularly in colorectal cancer (CRC) radiation sensitivity. Key findings include:

How should researchers design experiments to investigate Tlcd2's role in lipid metabolism?

When designing experiments to investigate Tlcd2's role in lipid metabolism, researchers should consider:

• Genetic models: Generate both cell line and animal models with Tlcd2 knockout, knockdown, or overexpression. Consider compound models with Tlcd1 deletion, as these proteins have overlapping functions.

• Lipidomic profiling: Employ comprehensive lipidomic approaches to analyze multiple lipid classes, focusing on PE species composition.

• Challenge experiments: Subject models to metabolic challenges (e.g., high-fat diet, Western diet) to reveal phenotypes that may not be apparent under standard conditions.

• Tissue-specific analyses: Examine multiple tissues, particularly liver, which shows pronounced phenotypes in Tlcd1/2 DKO mice.

• Subcellular fractionation: Isolate mitochondria and other organelles to determine compartment-specific effects on PE composition.

• Functional readouts: Include measurements of physiological outcomes such as inflammation markers, oxidative stress indicators, and mitochondrial function parameters.

• Time-course studies: Evaluate changes over time, especially in diet-induced models, to understand disease progression dynamics .

What are the key considerations when interpreting data from Tlcd2 knockout studies?

When interpreting data from Tlcd2 knockout studies, researchers should keep in mind several important considerations:

These considerations highlight the importance of comprehensive experimental design and careful data interpretation when studying Tlcd2 function .

How can researchers effectively study the interaction between Tlcd2 and lnc-TLCD2-1 in disease models?

To effectively study interactions between Tlcd2 and lnc-TLCD2-1 in disease models, researchers should consider these methodological approaches:

• Expression correlation analysis: Examine the correlation between Tlcd2 protein and lnc-TLCD2-1 expression across tissues and cell lines, particularly in cancer models.

• Dual manipulation experiments: Perform simultaneous manipulation of both Tlcd2 and lnc-TLCD2-1 (overexpression or knockdown) to identify potential functional interactions.

• Radiation response studies: Evaluate radiation sensitivity in models with altered expression of either or both molecules, as lnc-TLCD2-1 has been implicated in radiation resistance.

• RNA-protein interaction analysis: Use techniques like RNA immunoprecipitation (RIP) or cross-linking immunoprecipitation (CLIP) to determine if lnc-TLCD2-1 directly interacts with Tlcd2 or related proteins.

• miRNA interaction studies: Investigate the role of miR-193a-5p as a potential mediator of Tlcd2 and lnc-TLCD2-1 interactions, as this miRNA has been implicated in lnc-TLCD2-1 function.

• Clinical correlation: Analyze patient samples to determine if combined alterations in Tlcd2 and lnc-TLCD2-1 have prognostic significance beyond individual markers .

How might Tlcd2's role in PE metabolism be targeted for therapeutic applications?

Tlcd2's role in PE metabolism presents several potential therapeutic applications, especially for metabolic and inflammatory diseases:

• NAFLD/NASH treatment: Given that Tlcd1/2 DKO mice show attenuated development of non-alcoholic steatohepatitis, inhibiting Tlcd2 function might provide a novel therapeutic approach for NAFLD/NASH patients.

• Mitochondrial dysfunction: As Tlcd2 regulates mitochondrial PE composition, targeting this protein might help address conditions characterized by mitochondrial dysfunction.

• Inflammation modulation: The altered PE composition in Tlcd1/2 DKO mice affects inflammatory processes; targeting Tlcd2 might therefore provide a novel approach to modulate inflammation in various diseases.

• Cancer radiation sensitivity: Given the relationship between lnc-TLCD2-1 and radiation sensitivity in cancer, targeting the Tlcd2-related pathway might help overcome radiation resistance in certain cancers.

• Small molecule inhibitors: Development of small molecules that modulate Tlcd2 function could provide targeted approaches for altering PE composition in specific tissues.

The therapeutic potential of targeting Tlcd2 is supported by the phenotypic improvements observed in Tlcd1/2 DKO mice under metabolic stress conditions without significant adverse effects under standard conditions .

What are the implications of Tlcd2 research for understanding mitochondrial function in health and disease?

Research on Tlcd2 has significant implications for understanding mitochondrial function in health and disease:

• PE composition regulation: Tlcd2 regulates mitochondrial PE composition, which is critical for proper mitochondrial function, including membrane integrity, fusion/fission dynamics, and electron transport chain activity.

• Oxidative stress: The altered PE composition in Tlcd1/2-deficient models likely affects oxidative stress responses, which are central to many disease processes.

• Metabolic adaptation: Mitochondrial PE composition changes may influence the cell's ability to adapt to different metabolic conditions, such as nutrient availability or environmental stressors.

• Evolutionary conservation: The conservation of Tlcd2 function across species highlights the fundamental importance of regulated PE composition for mitochondrial function.

• Disease relevance: Mitochondrial dysfunction is implicated in numerous diseases, from metabolic disorders to neurodegenerative conditions, making Tlcd2's role in regulating mitochondrial PE composition broadly relevant to understanding disease pathogenesis.

These implications suggest that further research on Tlcd2 could provide valuable insights into fundamental aspects of mitochondrial biology with wide-ranging applications in health and disease .

How do epigenetic factors influence Tlcd2 expression and function in different tissues?

The influence of epigenetic factors on Tlcd2 expression and function remains an area requiring further research, but several considerations emerge:

• Tissue-specific expression patterns: Tlcd2 likely shows tissue-specific expression patterns that may be regulated by epigenetic mechanisms such as DNA methylation, histone modifications, or chromatin remodeling.

• Long non-coding RNA regulation: The identification of lnc-TLCD2-1 suggests a potential epigenetic regulatory mechanism involving non-coding RNAs that could influence Tlcd2 expression or function.

• microRNA interactions: The interaction between lnc-TLCD2-1 and miR-193a-5p points to a potential complex regulatory network involving competing endogenous RNA mechanisms that may epigenetically regulate Tlcd2.

• Disease-specific epigenetic changes: In disease states like cancer, epigenetic alterations may affect Tlcd2 expression patterns, potentially contributing to altered PE metabolism and cellular function.

• Developmental regulation: Epigenetic mechanisms likely regulate Tlcd2 expression during development, potentially contributing to tissue-specific PE composition patterns.

Future research should explore these epigenetic aspects of Tlcd2 regulation to better understand its tissue-specific functions and potential roles in disease processes .

What are the major challenges in studying Tlcd2 protein-protein interactions, and how can they be overcome?

Studying Tlcd2 protein-protein interactions presents several challenges due to its membrane-embedded nature and potentially transient interactions. These challenges and potential solutions include:

These approaches can help overcome the inherent difficulties in studying membrane protein interactions and provide insights into Tlcd2's functional partners in regulating PE metabolism .

What techniques are most effective for visualizing Tlcd2 localization and dynamics in living cells?

For visualizing Tlcd2 localization and dynamics in living cells, researchers should consider these effective techniques:

• Fluorescent protein fusions: Generation of Tlcd2-GFP (or other fluorescent protein) fusions can allow for live-cell imaging of Tlcd2 localization. Given Tlcd2's membrane topology, careful placement of the tag is critical to avoid disrupting function.

• Split fluorescent protein complementation: To study protein-protein interactions in live cells, split fluorescent protein approaches like BiFC (Bimolecular Fluorescence Complementation) can be employed.

• FRAP (Fluorescence Recovery After Photobleaching): This technique can reveal the mobility and dynamics of Tlcd2 within membranes.

• Super-resolution microscopy: Techniques like STORM or PALM can provide nanoscale resolution of Tlcd2 localization relative to other cellular structures.

• Correlative light and electron microscopy (CLEM): This approach can provide both functional information (from fluorescence) and ultrastructural context (from EM) for Tlcd2 localization.

• Optogenetic approaches: These can be used to manipulate Tlcd2 function with spatial and temporal precision while observing cellular responses.

When employing these techniques, researchers should validate that tagged versions of Tlcd2 retain normal function by complementation studies in knockout backgrounds .

How is Tlcd2 function conserved across different species, and what can we learn from evolutionary studies?

Tlcd2 function shows significant conservation across species, offering valuable insights from evolutionary studies:

• Functional conservation: Studies have demonstrated that the role of TLCD1/2 in regulating PE composition is conserved from mice to humans, suggesting a fundamental biological function.

• Structural homology: TLC domain-containing proteins are found across diverse species, indicating evolutionary pressure to maintain these structures for lipid metabolism regulation.

• Species-specific adaptations: While the core function is conserved, species-specific adaptations in Tlcd2 may reflect different metabolic demands or environmental pressures.

• Danio rerio (zebrafish) model: Research with zebrafish Tlcd2 orthologs can provide developmental insights that are challenging to study in mammalian systems.

• Cellular interaction conservation: The interaction of Tlcd2 with mitochondria appears evolutionarily conserved, highlighting the fundamental importance of this relationship for cellular metabolism.

Comparative biology approaches can reveal both conserved mechanisms and species-specific adaptations in Tlcd2 function, potentially identifying critical functional domains and interaction partners that have been maintained throughout evolution .

How do different models (cell lines, mouse models, human samples) compare in Tlcd2 research findings?

Different model systems have provided complementary insights into Tlcd2 function, with important similarities and differences:

What is the potential of Tlcd2 as a therapeutic target in metabolic and inflammatory diseases?

Based on research findings, Tlcd2 shows promise as a therapeutic target for several conditions:

• Non-alcoholic fatty liver disease (NAFLD): Tlcd1/2 DKO mice demonstrate protection against diet-induced liver disease, with reduced hepatic inflammation, fibrosis, and liver damage markers. This suggests that inhibiting Tlcd2 function could potentially slow NAFLD progression.

• Inflammation modulation: The altered PE composition in Tlcd1/2-deficient models affects inflammatory processes, indicating that targeting Tlcd2 might provide novel approaches for inflammatory conditions.

• Mitochondrial dysfunction disorders: Given Tlcd2's role in regulating mitochondrial PE composition, it might be relevant for conditions characterized by mitochondrial dysfunction.

• Specificity advantage: The tissue-specific effects observed in Tlcd1/2 DKO mice (primarily affecting liver without major systemic metabolic changes) suggest that targeting this pathway might provide relatively focused therapeutic effects.

• Combined targeting: Developing strategies that target both Tlcd1 and Tlcd2 might be necessary for maximum therapeutic effect, given their overlapping functions.

The favorable metabolic phenotypes observed in knockout models without major adverse effects under standard conditions suggest a potentially favorable therapeutic window for Tlcd2-targeted interventions .

How might knowledge of lnc-TLCD2-1 be applied to improve cancer treatment strategies?

Knowledge of lnc-TLCD2-1 offers several potential applications for improving cancer treatment:

• Radiation sensitivity prediction: lnc-TLCD2-1 expression levels could potentially serve as a biomarker to predict tumor radiation sensitivity, allowing for personalized radiation dosing.

• Radiation resistance intervention: Targeting lnc-TLCD2-1 could potentially overcome radiation resistance in colorectal cancer. Downregulation of lnc-TLCD2-1 in radiation-resistant cancer cells increases their radiation sensitivity.

• Prognostic biomarker: High expression of lnc-TLCD2-1 predicts poor survival in colorectal cancer patients, making it a potential prognostic biomarker for risk stratification.

• Combined targeting approaches: The interaction between lnc-TLCD2-1 and miR-193a-5p suggests potential for combined RNA-targeting therapeutic approaches.

• Patient selection: Identifying patients with high lnc-TLCD2-1 expression might help select those who would benefit most from intensive therapy or novel radiation sensitizing approaches.

These applications could contribute to more personalized and effective cancer treatment strategies, particularly for colorectal cancer patients undergoing radiation therapy .

What are the most promising unexplored aspects of Tlcd2 biology?

Several promising unexplored aspects of Tlcd2 biology warrant further investigation:

• Tissue-specific functions: While liver phenotypes are well-characterized, the role of Tlcd2 in other tissues, particularly brain, heart, and skeletal muscle, remains largely unexplored.

• Regulation of Tlcd2 expression: The mechanisms controlling Tlcd2 expression under different physiological and pathological conditions are poorly understood.

• Protein structure-function relationships: Detailed structural studies to understand how Tlcd2 promotes MUFA incorporation into PE at the molecular level are needed.

• Interaction partners: Comprehensive identification of Tlcd2's protein interaction network could reveal new insights into its cellular functions.

• Role in development: The importance of Tlcd2-regulated PE composition during embryonic and postnatal development remains to be explored.

• Cross-talk with other lipid metabolism pathways: How Tlcd2-mediated PE composition changes influence other lipid metabolism pathways is not fully understood.

• Non-metabolic functions: Potential roles of Tlcd2 beyond lipid metabolism, such as in signaling processes or membrane organization, warrant investigation .

What novel technologies or approaches could advance Tlcd2 research?

Several emerging technologies and approaches could significantly advance Tlcd2 research:

• CRISPR-based screening: Genome-wide or focused CRISPR screens could identify genetic interactors of Tlcd2, revealing new functional relationships.

• Single-cell lipidomics: Emerging technologies for single-cell lipid analysis could reveal cell-type-specific effects of Tlcd2 that are masked in bulk tissue analyses.

• Organoid models: Three-dimensional organoid cultures could provide more physiologically relevant systems for studying Tlcd2 function in tissue-specific contexts.

• In situ structural biology: Techniques like cryo-electron tomography could provide insights into Tlcd2's native structure within membranes.

• Spatially resolved transcriptomics/proteomics: These approaches could reveal spatial patterns of Tlcd2 expression and function within tissues.

• Machine learning for lipidomic data analysis: Advanced computational approaches could identify subtle patterns in complex lipidomic datasets from Tlcd2 studies.

• Targeted protein degradation: Technologies like PROTACs could provide more precise temporal control over Tlcd2 function than conventional knockout approaches.

• RNA therapeutics: Novel RNA-based therapeutic approaches could target lnc-TLCD2-1 for cancer applications or modulate Tlcd2 expression in metabolic diseases .

What should be the priorities for researchers entering the field of Tlcd2 biology?

For researchers entering the field of Tlcd2 biology, several priorities should guide their efforts:

• Mechanistic understanding: Elucidate the molecular mechanisms by which Tlcd2 promotes MUFA incorporation into PE molecules, including potential direct interactions with lipid biosynthetic enzymes.

• Structural characterization: Determine the three-dimensional structure of Tlcd2 protein to understand how it functions at the molecular level.

• Tissue-specific function: Investigate Tlcd2 function in tissues beyond the liver, particularly those with high mitochondrial content like heart, muscle, and brain.

• Therapeutic potential exploration: Further evaluate the potential of Tlcd2 inhibition as a therapeutic approach for NAFLD/NASH and other metabolic disorders.

• lnc-TLCD2-1 relationship: Clarify the functional relationship between Tlcd2 protein and lnc-TLCD2-1, particularly in the context of cancer biology.

• Translational validation: Verify that findings from mouse models translate to human physiology and pathology using appropriate human samples and model systems.

These priorities would address key knowledge gaps while building on the established foundations of Tlcd2 biology .

How can researchers best collaborate across disciplines to advance Tlcd2 understanding?

Advancing Tlcd2 understanding requires effective cross-disciplinary collaboration strategies:

• Lipidomics-biochemistry integration: Combine expertise in lipidomic analysis with biochemical approaches to understand the molecular mechanisms of Tlcd2 function.

• Clinical-basic science partnerships: Form collaborations between basic scientists studying Tlcd2 and clinicians treating NAFLD/NASH or colorectal cancer to facilitate translational research.

• Computational biology involvement: Engage computational biologists for complex data analysis, modeling of lipid metabolism networks, and prediction of protein-lipid interactions.

• Structural biology expertise: Partner with structural biologists to determine Tlcd2 protein structure using techniques like cryo-EM or X-ray crystallography.

• Technology development collaboration: Work with analytical chemists and bioengineers to develop improved methods for studying membrane proteins and lipid dynamics.

• Shared resources and standardization: Establish repositories for Tlcd2 reagents, model systems, and standardized protocols to facilitate reproducible research across laboratories.

• International consortia: Form international research networks to leverage diverse expertise and resources for comprehensive characterization of Tlcd2 biology.