Recombinant Mouse TM2 domain-containing protein 1 (Tm2d1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Tm2d1; Bbp; TM2 domain-containing protein 1; Amyloid-beta-binding protein; mBBP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-208
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tm2d1
Target Protein Sequence
SGAVGGEETPKCEDLRVGQYICKEPKINDATQEPVNCTNYTAHVQCFPAPKITCKDLSGN ETHFTGSEVGFLKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGF CGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP
Uniprot No.

Target Background

Function
May participate in amyloid-beta-induced apoptosis through interaction with beta-APP42.
Database Links
Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse TM2D1 protein?

Mouse TM2D1 contains a predicted N-terminal signal sequence and two transmembrane domains connected through a short intracellular loop. Within this loop, there is an evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif, which is also found in some G-protein coupled receptors and mediates conformational changes upon ligand binding . The protein has an extracellular region between the signal sequence and first transmembrane domain that is more divergent across species, while the transmembrane domains and intracellular loop are highly conserved throughout evolution .

How does mouse TM2D1 compare structurally to other TM2D family proteins?

TM2D1 is one of three highly conserved TM2 domain-containing proteins (TM2D1, TM2D2, TM2D3) encoded in mammalian genomes. All three share similar protein domain structures, including the signal sequence, two transmembrane domains, and the intracellular loop with the conserved DRF motif . The main differences are in the extracellular regions and C-terminal tails, with TM2D1 having a slightly longer C-terminal tail compared to TM2D2 and TM2D3 .

What are the known functions of mouse TM2D1?

Mouse TM2D1 functions primarily as a beta-amyloid binding protein . It has been implicated in several biological processes:

  • Beta-amyloid binding

  • Potential G-protein coupled receptor activity (though this has been contested)

  • Involvement in Notch signaling pathways during development

  • Roles in neurogenesis, particularly maternal-effect neurogenic phenotypes in Drosophila knockout models

  • Participation in phagocytosis processes

What roles does TM2D1 play in cancer progression?

Recent studies have shown that TM2D1 contributes to the epithelial-mesenchymal transition (EMT) in hepatocellular carcinoma (HCC) . High expression of TM2D1 has been found to be significantly correlated with:

Mechanistically, TM2D1 promotes AKT and β-catenin hyperactivation, which corresponds with molecular marker changes in the EMT signaling pathway, suggesting TM2D1 may be a potential therapeutic target in HCC .

How does TM2D1 expression correlate with clinical outcomes in cancer patients?

In a study of 195 HCC patients who underwent radical hepatectomy, high TM2D1 expression was identified as an independent prognostic factor for:

The following table summarizes the relationship between TM2D1 expression and clinical parameters:

ParametersTM2D1 expressionP value
Low (n = 109)High (n = 86)
Tumor size (cm)
< 57643
≥ 53343
Microvascular invasion
Absent9250
Present1736

What expression systems are suitable for producing recombinant mouse TM2D1?

Recombinant mouse TM2D1 can be produced in various expression systems, including:

  • Mammalian cell expression systems (particularly suitable for maintaining proper folding and post-translational modifications)

  • E. coli expression systems (may be used for structural studies, though with limitations for membrane proteins)

  • In vitro cell-free systems

The choice depends on the experimental requirements and the specific protein properties needed for the study. For functional studies requiring properly folded protein with correct post-translational modifications, mammalian expression systems are often preferred .

What purification methods yield the highest quality recombinant mouse TM2D1?

The most effective purification strategy typically involves:

  • Affinity chromatography using tags (His-tag is commonly used)

  • Size exclusion chromatography to remove aggregates and contaminants

  • Careful consideration of detergent selection when purifying membrane-associated proteins like TM2D1

  • Quality control steps including SDS-PAGE and Western blotting to confirm purity (>80% is typical for research applications)

For optimal results, the purified protein should be stored in PBS buffer either as a liquid or lyophilized powder, with long-term storage at -20°C to -80°C to maintain stability .

What are the optimal conditions for binding studies involving recombinant TM2D1 and beta-amyloid peptides?

When conducting binding studies between recombinant TM2D1 and beta-amyloid peptides:

  • Use freshly prepared or properly stored recombinant protein to ensure activity

  • Consider the oligomerization state of beta-amyloid peptides (monomeric, oligomeric, or fibrillar forms may interact differently)

  • Conduct experiments at physiologically relevant pH (7.2-7.4) and salt concentrations

  • For in vitro binding assays, techniques such as surface plasmon resonance (SPR), ELISA, or pull-down assays can be utilized

  • When assessing cellular interactions, fluorescently labeled proteins combined with microscopy or flow cytometry provide spatial and quantitative data

How do TM2D family proteins interact in the Notch signaling pathway?

Studies in Drosophila have revealed that all three TM2D proteins (TM2D1/CG10795, TM2D2/CG11103, and TM2D3/almondex) share similar maternal-effect neurogenic phenotypes when knocked out, suggesting they function together in embryonic neurogenesis . Overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling at the γ-secretase cleavage step . High-throughput proteomics data has detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, suggesting these proteins may form a protein complex . Interestingly, triple-knockout of all TM2D genes in Drosophila does not exhibit more severe phenotypes than single knockouts, further supporting their coordinated function .

What experimental approaches can determine if TM2D1 forms functional complexes with other proteins?

To investigate potential TM2D1 protein complexes:

  • Co-immunoprecipitation followed by mass spectrometry (Co-IP/MS) to identify interacting partners

  • Proximity labeling techniques (BioID, APEX) to identify proteins in close proximity to TM2D1 in living cells

  • Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) to study protein-protein interactions in living cells

  • Cross-linking mass spectrometry to map interaction interfaces

  • Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS) to determine complex stoichiometry and molecular weight

These approaches can be complemented with functional assays to assess the biological significance of identified interactions.

What is the relationship between TM2D1 and the AKT/β-catenin signaling pathway in cancer?

Research has demonstrated that TM2D1 promotes AKT and β-catenin hyperactivation in hepatocellular carcinoma, corresponding with molecular marker changes in EMT signaling . To further investigate this mechanism:

  • Phosphorylation states of AKT can be assessed following TM2D1 overexpression or knockdown

  • β-catenin nuclear translocation and target gene activation can be quantified using reporter assays

  • Co-immunoprecipitation can determine if TM2D1 physically interacts with components of the AKT or Wnt/β-catenin pathway

  • Pharmacological inhibitors of AKT or β-catenin can be used to determine if they rescue phenotypes caused by TM2D1 overexpression

  • In vivo models with conditional TM2D1 expression can evaluate effects on tumor progression and metastasis

How conserved is TM2D1 across different species, and what does this suggest about its function?

TM2D1 is highly conserved across metazoans, with particularly strong conservation in the transmembrane domains and the intracellular loop containing the DRF motif . This high degree of conservation suggests essential biological functions. The extracellular region shows more variation both across species and among TM2D family members . Orthologous genes are found in model organisms including mice, zebrafish, and Drosophila (CG10795) . Single knockout of Tm2d1 in mice is reported to be recessive embryonic lethal prior to E18.5, further supporting its critical developmental role .

What phenotypes emerge in different model organisms when TM2D1 is knocked out?

Knockout phenotypes across species reveal important insights:

  • In Drosophila, knockout of CG10795 (TM2D1 ortholog) causes severe maternal-effect neurogenic phenotypes, similar to knockouts of the other TM2D family members

  • In mice, preliminary data from the International Mouse Phenotyping Consortium indicates that Tm2d1 knockout is embryonic lethal before E18.5

  • In cell culture models, TM2D1 knockout in myeloid cell lines causes phagocytic defects

These conserved phenotypes across diverse species suggest TM2D1 has essential roles in development, particularly in neurogenesis and potentially in other cellular processes like phagocytosis.

How do functional differences between mouse and human TM2D1 impact experimental design and translational research?

When designing experiments using mouse TM2D1 with translational goals:

  • Compare protein sequences between mouse and human TM2D1 to identify conserved and divergent regions

  • Consider that while core functions appear conserved, species-specific interactions may exist

  • Validate findings from mouse models in human cell lines or tissues when possible

  • Use complementation studies where human TM2D1 is expressed in mouse knockout models to assess functional conservation

  • Remember that while TM2D3 (a related family member) shows evolutionary conservation of function between flies and humans in Notch signaling, similar validation for TM2D1 is needed

Cross-species rescue experiments can provide valuable insights into the evolutionary conservation of specific protein functions while highlighting any species-specific differences that may affect translational research.

What are the most reliable antibodies and detection methods for mouse TM2D1 in various experimental contexts?

For optimal detection of mouse TM2D1:

  • For Western blotting: Antibodies targeting conserved regions of the protein, particularly the intracellular loop or C-terminus, typically provide the most specific detection

  • For immunohistochemistry: Optimize fixation conditions as membrane proteins can be sensitive to overfixation

  • For immunofluorescence: Consider using tagged versions of TM2D1 (such as His-tagged or fluorescent protein fusions) for reliable detection in cellular localization studies

  • For tissue microarrays and clinical samples: Validate antibody specificity using positive and negative controls, including tissues from knockout animals when available

How can researchers effectively analyze TM2D1 expression and localization in tissues and cells?

For comprehensive analysis of TM2D1 expression and localization:

  • Combine mRNA analysis (qRT-PCR, RNA-seq) with protein detection (Western blot, immunohistochemistry) to verify expression levels

  • Use subcellular fractionation followed by Western blotting to determine protein distribution across cellular compartments

  • For high-resolution localization, super-resolution microscopy techniques such as STORM or PALM can reveal precise subcellular distribution

  • In tissue sections, use co-staining with markers of specific cellular compartments to determine colocalization patterns

  • For quantitative assessment in tissue microarrays, establish clear scoring criteria based on staining intensity and distribution as demonstrated in hepatocellular carcinoma studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.