Recombinant Mouse TM2 domain-containing protein 2 (Tm2d2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

The TM2D2 gene encodes a protein that contains a structural module related to the seven transmembrane domain G protein-coupled receptor superfamily . TM2D proteins have a predicted N-terminal signal sequence and two transmembrane domains connected by a short intracellular loop . Within this loop, a highly conserved aspartate-arginine-phenylalanine (DRF) motif is found, a sequence that mediates conformational change upon ligand binding in some G-protein coupled receptors . The region outside the cell between the signal sequence and the first transmembrane domain varies between species and among the three TM2D-containing proteins . The sequences of the two transmembrane domains and the intracellular loop are highly conserved throughout evolution and between the three TM2 domain-containing proteins .

TM2D Family and Alzheimer's Disease

TM2D3, a member of the TM2D family, is associated with Alzheimer’s disease (AD) . An exome-wide association study has shown that TM2D3 is significantly associated with an increased risk of developing late-onset Alzheimer's disease (LOAD) . A variant of TM2D3 was also associated with an earlier age of onset, corresponding to a difference of up to 10 years .

TM2D in Drosophila

Studies in Drosophila have shown that TM2D proteins regulate Notch signaling and neuronal function . Knocking out all three TM2D genes (almondex, CG11103/amaretto, CG10795/biscotti) in Drosophila results in a shared maternal-effect neurogenic defect . Overexpression of the most conserved region of the TM2D proteins inhibits Notch signaling at the γ-secretase cleavage step . Loss of Almondex in the brain causes a shortened lifespan accompanied by progressive motor and electrophysiological defects .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.

Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and storing in aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Tm2d2; TM2 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-213
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tm2d2
Target Protein Sequence
FNATAELDLTPSGAAHLEGPAASSWEYSDPNSPVILCSYLPDEFVDCDAPVDHVGNATAS QELGYGCLKFGGQAYSDVQHTAVQCRALEGIECASPRTFLRENKPCIKYTGHYFITTLLY SFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY
Uniprot No.

Target Background

Database Links

KEGG: mmu:69742

UniGene: Mm.28626

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TM2 domain-containing protein 2 (Tm2d2) and what is its structural organization?

Tm2d2 (also known as BLP1 in humans or amaretto/CG11103 in Drosophila) is one of three highly conserved TM2 domain-containing proteins encoded in the mammalian genome. The protein contains a distinctive structural organization that includes:

  • An N-terminal signal sequence

  • Two transmembrane domains connected through a short intracellular loop

  • An evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif within the intracellular loop

  • A short C-terminal extracellular tail

The DRF motif is particularly notable as this sequence is found in some G-protein coupled receptors where it mediates conformational changes upon ligand binding. While the extracellular region between the signal sequence and first transmembrane domain is divergent across species and among TM2D family proteins, the transmembrane domains and intracellular loop sequences are highly conserved throughout evolution .

What are the orthologs of Tm2d2 across different species and how conserved are they?

Tm2d2 demonstrates remarkable evolutionary conservation across metazoan species with a clear 1:1 ortholog relationship:

SpeciesTm2d1 OrthologTm2d2 OrthologTm2d3 Ortholog
HumanTM2D1TM2D2 (BLP1)TM2D3
MouseTm2d1Tm2d2 (Blp1)Tm2d3
Drosophilabiscotti (CG10795)amaretto (CG11103)almondex (amx)
Xenopustm2d1tm2d2tm2d3
Zebrafishtm2d1tm2d2tm2d3
C. elegansY66D12A.21C02F5.13C41D11.9

This 1:1 ortholog relationship is particularly noteworthy given that vertebrates underwent two rounds of whole-genome duplication during evolution, and teleosts including zebrafish underwent an additional round of genome duplication. Despite these events, each of the three TM2D genes has remained as single-copy genes in various species, suggesting selective pressure to maintain consistent gene dosage throughout evolution .

Where is Tm2d2 expressed in mouse tissues and at what developmental stages?

While comprehensive tissue-specific expression data for mouse Tm2d2 is limited in the provided search results, research in related systems provides valuable insights:

  • Tm2d2 is expressed in the brain, alongside other TM2D family proteins

  • Expression appears in multiple cell types beyond phagocytic cells in the nervous system

  • Preliminary phenotypic data from the International Mouse Phenotyping Consortium indicates that Tm2d2 knockout mice exhibit prenatal lethality, suggesting critical developmental functions during embryogenesis

For detection of Tm2d2 in various mouse tissues, researchers can employ immunohistochemistry techniques with available antibodies against Tm2d2, or utilize ELISA assays for quantitative measurement in tissue homogenates and biological fluids .

What are the most effective methods for detecting and quantifying Tm2d2 in experimental samples?

Several methodological approaches can be employed for detecting and quantifying Tm2d2:

Quantitative Detection (Protein Level):

  • Sandwich ELISA assays are available for mouse Tm2d2 quantification in cell culture supernatants, serum, plasma, and other biological fluids

  • Western blotting using Tm2d2-specific antibodies can be used for semi-quantitative analysis, particularly useful for detecting different isoforms

Localization Studies:

  • Immunohistochemistry (IHC-P, IHC-F) using purified polyclonal antibodies

  • Immunofluorescence (IF) and immunocytochemistry (ICC) for cellular and subcellular localization

Gene Expression Analysis:

  • RT-PCR for confirming transcript presence or knockout validation

  • qPCR for quantitative measurement of Tm2d2 expression levels

When setting up detection experiments, researchers should consider:

  • Using appropriate positive and negative controls (especially tissues from knockout models)

  • Validating antibody specificity using recombinant proteins

  • Optimizing dilutions for each application as specified in assay protocols

How can recombinant mouse Tm2d2 be effectively produced for research applications?

Production of recombinant mouse Tm2d2 presents specific challenges due to its transmembrane nature. Several expression systems can be utilized:

Mammalian Expression Systems:

  • HEK293 cells provide a reliable system for producing properly folded and post-translationally modified Tm2d2

  • This approach yields protein with native-like characteristics suitable for functional studies and antibody development

Specialized Purification Considerations:

  • Detergent selection is critical for solubilizing membrane proteins while maintaining structure

  • Affinity tags (such as His-tags) facilitate purification while minimizing interference with protein function

  • Size exclusion chromatography can be used to isolate monomeric vs. oligomeric forms

For researchers requiring significant quantities of purified protein, commercial recombinant mouse Tm2d2 products are available with verified activity. Most preparations are lyophilized and require reconstitution according to manufacturer protocols .

What experimental approaches are most effective for studying Tm2d2 loss-of-function?

Several genetic and molecular approaches have been successfully employed to study Tm2d2 loss-of-function:

CRISPR/Cas9-Mediated Knockout:

  • CRISPR/Cas9 has been effectively used to generate Tm2d2 knockout models by inserting dominant markers into the endogenous locus

  • This approach allows for verification of gene disruption through RT-PCR analysis of transcript absence

RNA Interference:

  • siRNA specific to mouse Tm2d2 (targeting gene ID: Blp1; 2410018G23Rik) with >97% purification is available for transient knockdown experiments

  • This approach is particularly useful for cell culture studies and avoids developmental compensation mechanisms

Validated Readouts for Loss-of-Function Studies:

  • Notch signaling pathway activity measurements

  • Electrophysiological function assessment in neural tissues

  • Phenotypic analysis focusing on craniofacial morphology and neural function

Data from the International Mouse Phenotyping Consortium on Tm2d2 knockout mice reveal specific phenotypes that can serve as readouts:

Allelic CompositionGenetic BackgroundPhenotype
Tm2d2^em1(IMPC)Bay/Tm2d2^+C57BL/6N-Tm2d2^em1(IMPC)Bay/BayDecreased startle reflex
Tm2d2^em1(IMPC)Bay/Tm2d2^em1(IMPC)BayC57BL/6N-Tm2d2^em1(IMPC)Bay/BayAbnormal craniofacial morphology, edema, prenatal lethality, preweaning lethality (complete penetrance)

These phenotypes provide specific endpoints that researchers can assess when studying Tm2d2 loss-of-function .

What role does Tm2d2 play in the Notch signaling pathway?

Tm2d2 and other TM2D family proteins appear to function at the γ-secretase cleavage step of Notch activation:

  • Maternal-Effect Neurogenic Function: Knockout studies in Drosophila demonstrate that all three TM2D genes, including the Tm2d2 ortholog amaretto (CG11103), share the same maternal-effect neurogenic defect, indicating essential roles in embryonic Notch signaling

  • Functional Redundancy: Triple knockout of all TM2D genes in Drosophila produced phenotypes similar to single gene knockouts, suggesting these proteins function together in Notch regulation

  • Inhibitory Function: Overexpression of the conserved region of TM2D proteins can act as a potent inhibitor of Notch signaling specifically at the γ-secretase cleavage step

  • Mechanistic Position: Genetic epistasis experiments position Tm2d family proteins at the γ-secretase cleavage step of Notch activation rather than earlier steps in the pathway

For researchers investigating Tm2d2's role in Notch signaling, appropriate experimental readouts include analysis of Notch target gene expression, monitoring γ-secretase activity, and assessing neurogenic phenotypes in developing embryonic tissues.

How is Tm2d2 potentially linked to neurodegenerative diseases like Alzheimer's?

While TM2D3 has the strongest documented connection to Alzheimer's disease (AD), multiple lines of evidence suggest Tm2d2 may also play a role in neurodegenerative pathology:

  • Functional Overlap: All three TM2D proteins appear to function together, with triple knockout animals showing similar phenotypes to single knockouts, suggesting the entire gene family may share disease-relevant functions

  • Γ-Secretase Interaction: TM2D proteins function at the γ-secretase cleavage step, which is critical for both Notch signaling and APP processing in Alzheimer's disease pathogenesis

  • Physical Interactions: High-throughput proteomics data based on co-immunoprecipitation mass spectrometry from human cells has detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, suggesting these proteins may form functional complexes

  • Amyloid Binding: TM2D1 (a related family member) can interact with Aβ42, Aβ40, and potentially APP, raising the possibility that Tm2d2 might have similar capabilities given the conserved domains across the family

For researchers investigating Tm2d2's potential role in neurodegeneration, appropriate experimental approaches include co-immunoprecipitation with Alzheimer's-related proteins, assessment of γ-secretase activity effects, and evaluation of age-dependent neurophysiological changes in Tm2d2 mutant models.

What are the phenotypic consequences of Tm2d2 disruption in mouse models?

Studies of Tm2d2 knockout mice have revealed several distinct phenotypes that provide insight into its biological functions:

Developmental Phenotypes:

  • Abnormal craniofacial morphology

  • Edema

  • Prenatal lethality

  • Preweaning lethality with complete penetrance

Neurological Phenotypes:

  • Decreased startle reflex

  • Potential electropsychological defects (as observed with Drosophila Tm2d ortholog knockouts)

These phenotypes align with observations from the International Mouse Phenotyping Consortium and suggest that Tm2d2 plays critical roles in embryonic development and neurological function. The complete penetrance of preweaning lethality particularly indicates an essential function during early development .

How can researchers effectively analyze pathway-level effects of Tm2d2 manipulation?

Analysis of Tm2d2 at the pathway level requires aggregation of gene expression data to overcome technical and biological variation. Several methodological approaches are recommended:

  • Pathway Activity Scoring: The OncoFinder algorithm shows superior effectiveness for analyzing pathway-level effects, offering reduced cross-platform variation compared to single gene expression analysis

  • Data Aggregation Effect: When transitioning from single gene products to pathway-level analysis, biologically significant correlations can be restored through data aggregation effects that reduce technical noise

  • Mathematical Modeling of Pathway Effects:

    • Apply Monte Carlo trials to simulate both biased and unbiased case-to-normal ratios (CNR)

    • Compare correlation coefficients between methods using pathway-based vs. individual gene product-based log CNR values

    • Calculate benefit ratios to quantify advantages of pathway-level analysis

The effectiveness of this approach depends on several factors:

ScenarioConditionBenefit of Pathway Analysis
Biased, noisy datasetsExpression profiles significantly different from controlsHigh (4.5-fold decrease in variation)
Unbiased datasetsExpression profiles similar to controlsLimited
High gene count pathwaysMore genes in pathwayGreater benefit
Weak initial correlationInitial data has poor platform-to-platform correlationStronger effect

This methodological approach is particularly relevant for Tm2d2 research given its involvement in complex signaling pathways like Notch, where multiple interacting components contribute to phenotypic outcomes .

What approaches can be used to study potential interactions between Tm2d family proteins?

Evidence suggests TM2D family proteins may function together, with potential physical interactions forming functional complexes. Researchers can investigate these interactions using:

Physical Interaction Studies:

  • Co-immunoprecipitation followed by western blotting or mass spectrometry

  • Proximity ligation assays for detecting in situ protein interactions

  • FRET or BiFC for analyzing protein proximity in living cells

Functional Interaction Studies:

  • Combinatorial gene knockouts (single, double, and triple knockouts)

  • Genetic rescue experiments using individual family members

  • Domain swapping between family members to identify functional regions

Recommended Experimental Design:

  • Generate constructs expressing tagged versions of each Tm2d family protein

  • Perform reciprocal co-immunoprecipitation experiments

  • Compare phenotypes between single knockouts and combinatorial knockouts

  • Test rescue capabilities across family members

High-throughput proteomics has already detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3, supporting the hypothesis that these proteins function together in a complex . For robust results, researchers should include appropriate controls and confirm antibody specificity for each family member.

How can researchers effectively compare Tm2d2 function across different experimental models and species?

Given the high conservation of Tm2d2 across species, cross-species functional comparison provides valuable insights. Recommended methodological approaches include:

Cross-Species Comparison Framework:

  • Ortholog Identification: Use phylogenetic analysis to confirm true ortholog relationships

  • Conserved Domain Analysis: Focus experimental manipulations on highly conserved domains (e.g., TM domains, DRF motif)

  • Complementation Testing: Test functional rescue across species boundaries

Experimental Approaches:

  • Domain-Specific Constructs: Generate constructs focusing on both conserved regions (TM domains, DRF motif) and divergent regions (extracellular domains) to identify functionally critical elements

  • Cross-Species Rescue: Test whether mouse Tm2d2 can rescue phenotypes in invertebrate models (e.g., Drosophila amaretto mutants)

  • Pathway Conservation Analysis: Compare involvement in conserved pathways (e.g., Notch signaling) across species

Data Aggregation and Analysis:

  • Apply mathematical modeling approaches to quantify the data aggregation effect when comparing results across platforms and species

  • Use OncoFinder algorithm for pathway-level comparisons to reduce cross-platform variation

This methodological framework is particularly powerful because TM2D family genes show remarkable 1:1 ortholog relationships across diverse species from C. elegans to humans, suggesting conserved functional roles throughout evolution .

What role might Tm2d2 play in phagocytosis and immune function?

Recent large-scale CRISPR-based screening identified all three TM2D genes as novel regulators of phagocytosis in myeloid cells. For researchers investigating this emerging function:

  • Experimental Models: Utilize myeloid cell lines with CRISPR-mediated Tm2d2 knockout

  • Functional Assays: Assess phagocytic capacity using standardized substrates of varying sizes and materials

  • Comparative Analysis: Compare phenotypic effects across all three TM2D family knockouts

  • Tissue Specificity: Investigate expression and function in diverse phagocytic cell types beyond the nervous system

While the exact mechanism remains to be determined, this function may connect to broader roles in cellular homeostasis and disease processes, potentially including clearance of protein aggregates relevant to neurodegenerative conditions.

How can transcriptomics and proteomics be effectively leveraged to understand Tm2d2 function?

High-throughput approaches offer powerful insights into Tm2d2 function across developmental stages and disease contexts:

Recommended Methodological Framework:

  • Single-Cell RNA-Seq: Map cell type-specific expression patterns across tissues and developmental timepoints

  • Proteomics: Identify Tm2d2 interacting partners using proximity labeling approaches (BioID, APEX)

  • Data Integration: Apply pathway-level analysis to overcome batch effects and technical variation

Technical Considerations:

  • Apply data aggregation approaches at the pathway level to enhance robustness

  • Select appropriate control samples to maximize detection of biologically meaningful differences

  • Increase statistical power by including more gene products in pathway analysis

Expected Research Outcomes:

  • Identification of cell types where Tm2d2 functions are most critical

  • Mapping of protein interaction networks around Tm2d2

  • Detection of pathway-level perturbations following Tm2d2 manipulation

This integrative approach will help resolve contradictions in the current literature and provide a more comprehensive understanding of Tm2d2's multifaceted functions across developmental and disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.