Recombinant Mouse TM2 domain-containing protein 3 (Tm2d3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tm2d3; TM2 domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
45-261
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
IKDPGPTRTFSVVPRAAENQLFSHLTESTEIPPYMTKCPSNGLCSRLPADCIECATNVSC TYGKPVTFDCTVKPSVTCVDQDLKPQRNFVINMTCRFCWQLPETDYECSNSTTCMTVACP RQRYFANCTVRDHIHCLGNRTFPKLLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR EGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI
Uniprot No.

Target Background

Database Links
Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of mouse TM2 domain-containing protein 3 (Tm2d3)?

Mouse Tm2d3 contains a structural module related to the seven transmembrane domain G protein-coupled receptor superfamily. The protein features a predicted N-terminal signal sequence and two transmembrane domains connected through a short intracellular loop. Within this loop is an evolutionarily conserved DRF (aspartate-arginine-phenylalanine) motif found in some G-protein coupled receptors that mediates conformational changes upon ligand binding. The deduced 221-amino acid protein contains several features of a G protein-coupled receptor, including the two putative transmembrane domains in its C-terminal half, the DRY motif, and conserved cysteines and lysines .

How does Tm2d3 relate to other TM2D family proteins?

Tm2d3 is one of three highly conserved TM2 domain-containing proteins encoded in the mouse genome. The other two proteins, Tm2d1 and Tm2d2, share a similar domain structure with Tm2d3. All three proteins have highly conserved sequences in their transmembrane domains and intracellular loops, while the extracellular regions between the signal sequence and first transmembrane domain are more divergent. The three proteins also have short C-terminal extracellular tails that are evolutionarily conserved but vary among the three proteins (e.g., Tm2d1 has a slightly longer C'-tail than Tm2d2 and Tm2d3) .

What are the known functions of mouse Tm2d3?

Mouse Tm2d3 has been implicated in several biological processes. Studies suggest it plays a role in:

  • Notch signaling regulation, particularly at the γ-secretase cleavage step

  • Neuronal survival and function

  • Phagocytosis regulation

Knockout studies in mice indicate that Tm2d3 is essential for embryonic development, as single knockout mice are embryonic lethal prior to E18.5. The protein is widely expressed in various tissues, with notable expression in neurons of the hippocampus/entorhinal cortex and neocortical regions .

How can I assess Tm2d3 expression in different tissues?

For quantitative measurement of mouse Tm2d3 in different tissues, ELISA is the preferred method. Commercial mouse Tm2d3 ELISA kits are available that employ a two-site sandwich ELISA methodology. These kits typically use:

  • A pre-coated microplate with an antibody specific for Tm2d3

  • Biotin-conjugated antibody specific for Tm2d3

  • Streptavidin-conjugated Horseradish Peroxidase (HRP)

  • Substrate solution for color development

The assay can detect Tm2d3 in tissue homogenates, cell lysates, and other biological fluids. Northern blot analysis has also been used to detect variable expression of a 1.4-kb BLP2 transcript across different tissues. For spatial localization, in situ hybridization can be employed, which has revealed extensive expression in neurons of specific brain regions .

What are the best methods for studying Tm2d3 function in vivo?

Based on current research, several experimental approaches have proven effective for studying Tm2d3 function:

  • CRISPR/Cas9-mediated knockout: This has been successfully used to generate Tm2d3 null mice and in Drosophila models to study its ortholog (almondex/amx).

  • Cross-species functional rescue experiments: Human TM2D3 can partially rescue phenotypes in Drosophila Tm2d3 ortholog (amx) mutants, demonstrating evolutionary conservation of function. This approach can be used to test functional consequences of specific variants.

  • Lifespan and age-dependent phenotype assessment: In Drosophila, loss of the Tm2d3 ortholog (amx) causes significantly reduced lifespan (median 27 days vs. 51 days in controls) and progressive electrophysiological defects, providing a model to study age-dependent neurological phenotypes.

  • Electrophysiological recordings: These have been used to detect progressive neuronal function decline in Tm2d3-deficient models .

How can I design experiments to study Tm2d3's role in Alzheimer's disease?

To investigate Tm2d3's role in Alzheimer's disease, consider these experimental approaches:

  • Variant functional characterization:

    • Generate recombinant mouse Tm2d3 with disease-associated variants (e.g., the equivalent of human p.P155L and p.P69L)

    • Test their function using rescue experiments in Drosophila or mouse models

  • Notch signaling assessment:

    • Measure Notch signaling components in Tm2d3 variant models

    • Study γ-secretase activity and processing of Notch and APP in Tm2d3-deficient cells

  • Interaction with other AD-related pathways:

    • Investigate potential interactions between Tm2d3 and other AD risk genes

    • Examine effects on amyloid plaque formation and tau pathology

  • Age-dependent phenotypes:

    • Assess progressive neuronal dysfunction using electrophysiology

    • Measure cognitive performance in conditional knockout animal models .

How do the three TM2D family proteins functionally interact?

Evidence suggests that TM2D1, TM2D2, and TM2D3 may function together as a complex. When designing experiments to study their interactions:

  • Protein complex analysis:

    • Co-immunoprecipitation followed by mass spectrometry (co-IP/MS) has detected physical interactions between TM2D1-TM2D3 and TM2D2-TM2D3 in human cells

    • Use proximity labeling approaches like BioID or APEX to identify protein-protein interactions in their native cellular context

  • Combinatorial gene knockout:

    • In Drosophila, triple knockout of all three TM2D genes phenocopies single knockouts, suggesting they function in the same pathway

    • Design experiments that test combinations of knockouts in mammalian systems

  • Domain mapping:

    • Target the highly conserved transmembrane domains and intracellular loops to identify critical regions for protein interactions

    • Use chimeric proteins to identify domains responsible for specific functions .

What is the relationship between Tm2d3 and the γ-secretase complex in Notch signaling?

To investigate the molecular mechanism connecting Tm2d3 to γ-secretase and Notch signaling:

  • Overexpression studies:

    • Research shows that overexpression of the most conserved region of TM2D proteins acts as a potent inhibitor of Notch signaling at the γ-secretase cleavage step

    • Design experiments to identify which specific domains interfere with γ-secretase activity

  • Biochemical interaction studies:

    • Examine direct protein-protein interactions between Tm2d3 and γ-secretase components

    • Use FRET or BiFC techniques to visualize these interactions in living cells

  • Substrate processing analysis:

    • Measure processing of known γ-secretase substrates (Notch, APP) in the presence of wild-type and mutant Tm2d3

    • Analyze effects on NICD (Notch intracellular domain) and Aβ generation

  • Structure-function studies:

    • Use cryo-EM or other structural biology approaches to examine how Tm2d3 might interact with or modify γ-secretase structure .

What are the challenges in producing and working with recombinant mouse Tm2d3?

Working with recombinant Tm2d3 presents several technical challenges:

  • Membrane protein expression:

    • As a transmembrane protein, Tm2d3 can be difficult to express in soluble form

    • Consider using specialized expression systems for membrane proteins, such as insect cells or mammalian expression systems

  • Protein purification:

    • Use appropriate detergents for membrane protein solubilization (e.g., DDM, CHAPS)

    • Consider purification with the native lipid environment intact using nanodiscs or amphipols

  • Functional assays:

    • Develop cell-based assays that can detect proper folding and function

    • Consider incorporating the recombinant protein into liposomes to study its activity in a membrane environment

  • Antibody specificity:

    • Validate antibodies for cross-reactivity with other TM2D family members

    • Use knockout cell lines or tissues as negative controls .

How can I verify the functionality of recombinant mouse Tm2d3 in experimental systems?

To ensure recombinant Tm2d3 is functionally active:

  • Rescue experiments:

    • Test whether recombinant Tm2d3 can rescue phenotypes in Tm2d3-deficient cells or model organisms

    • The Drosophila rescue system has been validated for this purpose

  • Binding assays:

    • Verify interaction with known binding partners

    • Test for conserved functions like effects on Notch signaling

  • Structural integrity assessment:

    • Use circular dichroism or limited proteolysis to verify proper folding

    • Confirm membrane integration in reconstituted systems

  • Functional readouts:

    • Measure effects on γ-secretase activity

    • Assess impact on phagocytosis in appropriate cell types .

What is the significance of Tm2d3's role in phagocytosis for neurodegenerative disease research?

The identification of all three TM2D genes in a CRISPR-based screen for phagocytosis regulators opens new research directions:

  • Microglial function:

    • Investigate how Tm2d3 affects microglial phagocytosis of Aβ plaques or cellular debris

    • Study the impact of disease-associated variants on phagocytic efficiency

  • Synaptic pruning:

    • Examine whether Tm2d3 plays a role in developmental or pathological synaptic pruning

    • Test if Tm2d3 dysfunction could lead to inappropriate synaptic elimination in disease models

  • Protein clearance mechanisms:

    • Study how Tm2d3 might influence the clearance of aggregated proteins in neurodegenerative diseases

    • Investigate potential roles in autophagy or other protein degradation pathways

  • Inflammatory regulation:

    • Assess whether Tm2d3's phagocytic role extends to regulation of inflammatory responses

    • Examine potential connections to neuroinflammation in AD models .

How might high-throughput screening approaches identify therapeutic targets related to Tm2d3 function?

To develop therapeutic strategies targeting the Tm2d3 pathway:

  • Small molecule screening:

    • Design assays that measure Tm2d3's effect on Notch signaling or phagocytosis

    • Screen for compounds that normalize function of disease-associated variants

  • Genetic modifier screens:

    • Use CRISPR screens to identify genes that suppress or enhance Tm2d3-related phenotypes

    • Look for druggable targets in these pathways

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data from Tm2d3 models

    • Identify key nodes in affected networks that could serve as intervention points

  • Pathway-based therapeutics:

    • Target downstream effectors if direct Tm2d3 modulation proves challenging

    • Consider approaches that enhance remaining Tm2d3 function in cases of partial loss-of-function variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.