Recombinant Mouse Torsin-1A-interacting protein 1 (Tor1aip1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Torsin-1A-Interacting Protein 1 (Tor1aip1)

Torsin-1A-Interacting Protein 1 (TOR1AIP1), also known as LAP1 (Lamina-Associated Polypeptide 1), is a protein that, in humans, is encoded by the TOR1AIP1 gene . It is a nuclear envelope protein expressed in most human tissues and is linked to various biological processes and human diseases . TOR1AIP1 is crucial for maintaining the integrity of the nuclear membrane and is essential for the correct localization of TOR1A and TOR1B on the nuclear membrane, where it stimulates their ATPase activity .

Function and Interactions

TOR1AIP1 interacts with TorsinA, an AAA+ ATPase located in the lumen of the nuclear envelope, and is thought to activate it . The C-terminal luminal domain of TOR1AIP1 shares high homology with the C-terminal domain of LULL1, another protein that interacts with TorsinA in the endoplasmic reticulum . Additionally, TOR1AIP1 has lamin binding activity and participates in nuclear membrane organization and the positive regulation of ATP-dependent activity .

TOR1AIP1 in Disease

Mutations in TOR1AIP1 are associated with a range of disorders, including:

  • Congenital Myasthenic Syndrome (CMS): A mutation in TOR1AIP1 can lead to impaired neuromuscular transmission, resulting in fatiguable muscle weakness .

  • Limb-Girdle Muscular Dystrophy: Rare recessive mutations in TOR1AIP1 have been reported to cause limb-girdle muscular dystrophy .

  • Dystonia: Some mutations in TOR1AIP1 can result in dystonia .

  • Cardiomyopathy: Cardiac involvement has been observed in some cases of TOR1AIP1 mutations .

  • Multisystemic Disease: Severe mutations can cause a multisystem disorder with or without progeroid features .

The phenotypic spectrum of TOR1AIP1 mutations varies, with some mutations affecting only the LAP1B isoform resulting in milder clinical presentations compared to those affecting both LAP1B and LAP1C isoforms .

TOR1AIP1 and Cancer

TOR1AIP1's involvement in cancer is being explored, with studies indicating its potential as a predictive biomarker in cancer prognosis and therapy . Analysis of multiple databases reveals significant deregulation of TOR1AIP1 expression in various cancer types, particularly kidney renal clear cell carcinoma .

Mouse Model Studies

Mouse models with conditional knockout of Tor1aip1 in striated muscle (M-LAP1 -/-) have been used to study the effects of LAP1 deficiency on neuromuscular function . These models exhibit muscle weakness and impaired neuromuscular transmission, providing insights into the pathogenic mechanisms underlying TOR1AIP1-related disorders .

Genetic Variants

The Global Variome shared LOVD database contains information on various TOR1AIP1 gene variants, including their classification and potential impact . Some variants are classified as benign or likely benign, while others are associated with disease phenotypes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tor1aip1; Torsin-1A-interacting protein 1; Lamina-associated polypeptide 1B; LAP1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-595
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAGERWQAEGPGEGWAIYVTPRAPIREGRRRLDPRNGDSSDAPAYGAHPSRRGRREVRFS EEPAEVYGDFEPRAAKERSPGGRRTPPEKFRPASAGEEVRESAYNLRSRPRRQRRAQEAE EMKTRRSARLEQHSQQPQLSPATSGRGLRDSPSSSEDREEDEPSSRPVTSQTASKKTLRT PEASVMNEDPISNLCRPPLRSPRLDSTYQTNGNTKTNEREATIVQQVNFFEEGETEDDLE SSYSDITIRARSSDSLESRDEATPAAGNHPDSLRGLPHNQDFPAHENQPLLLTSGCQENP QEWVDRAVRMRSRMAYNNIQKSNFGNQSPSTSRPQSAIHHPNEPSVKIKWWLLGLVAILA VGLFWFFHTPAVETTAVQEFQNQMKQLQSKYQSQNEKLWKRGTTFLEKHLNSSLPRPQPA ILLLTAAQDAAEVLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLVKHEVDQELTDG FKNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEKTLEASLGLKEI EEKVRDFLKVKFTSSSTASSYNHMDPDKLNGLWSRISHLVLPVQPENTLKAGSCL
Uniprot No.

Target Background

Function

Torsin-1A-interacting protein 1 (Tor1aip1) is essential for maintaining nuclear membrane integrity. It induces ATPase activity in TOR1A and TOR1B, and is required for their localization on the nuclear membrane. Tor1aip1 binds to A- and B-type lamins, suggesting a role in membrane attachment and nuclear lamina assembly.

Gene References Into Functions
  1. LAP1 interacts physically and functionally with emerin and plays an essential and selective role in skeletal muscle maintenance. PMID: 24055652
Database Links
Protein Families
TOR1AIP family
Subcellular Location
Nucleus inner membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the spinal cord and liver (at protein level).

Q&A

What is Torsin-1A-interacting protein 1 (Tor1aip1)?

Tor1aip1 is a gene that encodes lamina-associated polypeptide 1 (LAP1), a type-2 integral membrane protein localized in the inner nuclear membrane. LAP1 binds to both A- and B-type lamins and is involved in the regulation of torsinA ATPase activity. It plays crucial roles in maintaining nuclear membrane morphology and participates in various cellular processes. The protein is widely expressed in both neuronal and non-neuronal tissues during embryogenesis and adulthood .

What are the known isoforms of LAP1 in mouse models?

Multiple LAP1 isoforms have been identified across species. In mice, several transcript variants exist due to alternative splicing mechanisms. Bioinformatic analysis and sequencing studies have revealed that mouse LAP1 has unique exons (termed 1b, 3b, and 5b) that contribute to isoform diversity . These different isoforms likely have specialized functions in various tissues and developmental stages, though their specific roles are still being characterized through ongoing research .

How does Tor1aip1 expression vary across different tissues?

LAP1 expression patterns show significant tissue specificity. While LAP1 is widely expressed in both neuronal and non-neuronal tissues, the expression levels vary considerably. Studies have shown that LAP1 is present during embryogenesis and continues into adulthood across multiple tissue types. Notably, LAP1 has been found in brain, liver, striated muscle (cardiac), kidney, and skin tissues, indicating its ubiquitous but differentially regulated expression pattern .

What is the functional relationship between torsinA and LAP1?

LAP1 (encoded by Tor1aip1) functions cooperatively with torsinA to maintain normal nuclear membrane morphology. Studies of knockout mice have demonstrated that LAP1-null mice develop neuronal nuclear membrane abnormalities indistinguishable from those observed in torsinA mutant mice. This establishes a clear functional relationship between these proteins. Interestingly, while torsinA mutations cause nuclear membrane abnormalities selectively in neurons, LAP1 deficiency produces similar abnormalities in both neuronal and non-neuronal tissues, suggesting that LAP1 participates in a widespread cellular process to which neurons are particularly vulnerable .

How does torsinB compensate for torsinA dysfunction in non-neuronal cells?

TorsinB, another member of the torsin family, demonstrates significantly higher expression levels in non-neuronal tissues compared to neural tissues. This expression difference appears to be protective: high levels of torsinB can compensate for torsinA dysfunction specifically in non-neuronal cells. When torsinB is depleted in non-neuronal cells from torsinA mutant mice using RNAi, nuclear membrane abnormalities develop that are typically only seen in neurons. This explains why torsinA mutations cause a neural-selective phenotype - neurons express lower levels of torsinB and are therefore more susceptible to torsinA dysfunction .

What role does Tor1aip1 play in nuclear envelope integrity?

Tor1aip1-encoded LAP1 is critical for maintaining nuclear envelope integrity. Ultrastructural studies of LAP1-null tissues reveal characteristic nuclear membrane "blebs" - membranous vesicle-appearing structures in the perinuclear space. These abnormalities appear in all brain regions examined in LAP1-null mice, including striatum, cortex, thalamus, and spinal cord. In humans, TOR1AIP1 mutations have been linked to nuclear envelope alterations including nuclear fragmentation, chromatin bleb formation, and naked chromatin. These findings establish LAP1 as an essential component for preserving nuclear envelope structure and function .

What are the recommended approaches for studying Tor1aip1 knockout models?

When studying Tor1aip1 knockout models, researchers should employ a multifaceted approach combining genomic, cellular, and ultrastructural methodologies. Gene trap cassette disruption of the Tor1aip1 locus has proven effective for generating knockout mice. Western blot analysis on tissue lysates should be performed to confirm the complete loss of anti-LAP1 immunoreactive bands. Electron microscopy (EM) is essential for examining nuclear membrane ultrastructure and identifying characteristic abnormalities like nuclear membrane "blebs." Additionally, immunostaining for nuclear membrane proteins should be conducted to assess whether subcellular localization and expression levels remain intact despite LAP1 deficiency .

How can researchers effectively analyze Tor1aip1 expression patterns across tissues?

For comprehensive analysis of Tor1aip1 expression across tissues, researchers should employ multiple complementary techniques. Quantitative RT-PCR provides reliable measurement of transcript levels in different tissues. For protein-level analysis, Western blotting with appropriate antibodies against LAP1 isoforms is recommended. When comparing neuronal versus non-neuronal expression, researchers should analyze both whole tissue extracts and purified cell populations (neurons, glia, and fibroblasts) to accurately reflect cell-type-specific expression differences. Immunohistochemistry can provide spatial resolution of expression patterns within complex tissues. Expression data should be normalized to appropriate housekeeping genes or proteins to ensure accurate comparisons .

What methods are most effective for studying LAP1 isoform diversity?

To study LAP1 isoform diversity effectively, researchers should combine bioinformatic analysis with experimental validation. Begin with in silico analysis of the Tor1aip1 gene to identify potential alternative exons and splice variants. BLAST algorithms can be used to align transcripts against genomic sequences, while tools like NNSPLICE and GENSCAN help identify intron-exon junctions. RT-PCR with isoform-specific primers can then verify predicted transcript variants. For protein-level confirmation, use Western blotting with antibodies that can distinguish between isoforms based on molecular weight differences. Mass spectrometry provides the most definitive identification of protein isoforms and can detect post-translational modifications that may further diversify LAP1 function .

How is Tor1aip1 implicated in muscular dystrophies?

Mutations in TOR1AIP1 have been directly linked to a form of muscular dystrophy in humans. Genome-wide homozygosity mapping identified a homozygous c.186delG mutation in TOR1AIP1 that causes a frameshift resulting in a premature stop codon (p.E62fsTer25). This mutation leads to complete absence of LAP1B expression in skeletal muscle fibers. The clinical manifestations include proximal and distal weakness and atrophy, rigid spine, and contractures of hand joints, along with cardiomyopathy and respiratory involvement. Ultrastructural examination reveals alterations of the nuclear envelope, including nuclear fragmentation and chromatin bleb formation. This establishes TOR1AIP1 as a causative gene for nuclear envelopathies and highlights LAP1B's critical function in striated muscle maintenance .

What is the evidence for Tor1aip1's role as a cancer biomarker?

Recent comprehensive database analyses have identified TOR1AIP1 as a potential predictive and immunological biomarker in multiple cancer types. Studies show significant deregulation of TOR1AIP1 expression across various cancers, with particularly notable patterns in kidney renal clear cell carcinoma. Expression levels have been correlated with clinical outcomes including survival rates and drug sensitivity. The evidence suggests TOR1AIP1 may have predictive value in cancer prognosis and therapy selection. Researchers investigating this angle should perform multi-database analyses examining expression patterns across cancer types and stages, while also correlating findings with clinical outcomes to establish predictive significance .

How does Tor1aip1 contribute to the neural-specific phenotype of DYT1 dystonia?

DYT1 dystonia is a CNS-specific disorder caused by a 3-bp deletion ("ΔE") in the widely expressed TOR1A gene. The neural-specific nature of this disease is partially explained by the functional relationship between torsinA and LAP1. Studies show that torsinA mutant mice (Tor1aΔE/ΔE) exhibit disrupted nuclear membranes selectively in neurons, mimicking the tissue specificity of the human disease. This selectivity appears to result from differential expression of torsinB between neuronal and non-neuronal cells. Neurons express significantly lower levels of torsinB compared to non-neuronal cells, making them more vulnerable to torsinA dysfunction. This illustrates how Tor1aip1-related pathways can contribute to the tissue-specific manifestation of ubiquitous genetic defects .

What are the molecular mechanisms underlying the compensatory effects between LAP1 and LULL1?

The relationship between LAP1 and luminal domain-like LAP1 (LULL1) involves complex compensatory mechanisms. In patients with LAP1B deficiency due to TOR1AIP1 mutations, LULL1 (an endoplasmic reticulum-localized partner of torsinA) shows overexpression in muscle tissue. This suggests a regulatory feedback mechanism where loss of one protein triggers upregulation of the other. The molecular basis likely involves shared structural domains and overlapping functions in torsinA regulation. Researchers investigating this phenomenon should employ proteomic approaches to map interaction networks and quantitative expression analyses to document compensatory changes under various experimental conditions. Functional studies using RNAi knockdown or CRISPR-based editing of both genes simultaneously could further elucidate their interdependent roles .

How do torsin family members exhibit functional redundancy in cellular processes?

Torsin family proteins (including torsinA, torsinB, torsin2, and torsin3) demonstrate variable degrees of functional redundancy that appears to be tissue and context dependent. Research indicates that torsinB can functionally compensate for torsinA deficiency specifically in non-neuronal cells, which express significantly higher levels of torsinB than neurons. Similarly, expression patterns of torsin3 mirror those of torsinB, suggesting potential redundant functions. To investigate this complex redundancy network, researchers should employ combinatorial knockout/knockdown approaches targeting multiple torsin family members simultaneously. Tissue-specific conditional knockout models provide valuable tools for dissecting redundant functions in different cellular contexts. Quantitative expression profiling across tissues and developmental stages can help identify potential compensatory relationships between family members .

What are the structural determinants of LAP1 interaction with nuclear envelope components?

LAP1 functions as a type-2 integral membrane protein in the inner nuclear membrane, where it interacts with multiple nuclear envelope components. Key structural features include its ability to bind both A-type and B-type lamins, as well as its involvement in regulating torsinA ATPase activity. Researchers investigating these structural determinants should employ techniques like hydrogen-deuterium exchange mass spectrometry to identify interaction interfaces, and mutation studies to pinpoint critical residues. X-ray crystallography or cryo-electron microscopy of LAP1 complexes with binding partners would provide definitive structural insights. Computational molecular modeling can predict interaction surfaces based on sequence conservation and physicochemical properties. Understanding these structural determinants is crucial for developing targeted interventions for diseases involving nuclear envelope dysfunction .

What expression patterns does Tor1aip1 show across different cancer types?

Table 1: TOR1AIP1 Expression Patterns in Major Cancer Types

Cancer TypeExpression PatternCorrelation with PrognosisPotential as Biomarker
Kidney Renal Clear Cell CarcinomaSignificantly deregulatedStrong correlation with survivalHigh potential
Other Cancer TypesVariable deregulationUnder investigationRequires further validation

How do tissue-specific expression levels of torsin family members correlate with phenotypes?

Table 2: Comparative Expression of Torsin Family Members in Different Tissues

Protein/mRNANeural TissueNon-neural TissueFunctional Implication
TorsinA proteinHigherLowerCritical for neuronal function
TorsinB proteinSignificantly lowerSignificantly higherCompensatory protection in non-neural cells
Tor2a mRNASimilarSimilarUbiquitous function
Tor3a mRNAMarkedly lowerMarkedly higherPotential redundancy with torsinB

The differential expression patterns of torsin family members across tissues provides crucial insight into the neural-specific phenotypes observed in certain torsin-related disorders. TorsinB shows dramatically higher expression in non-neural compared to neural tissues, while torsinA shows somewhat higher expression in neural tissues. Similarly, Tor3a mRNA levels are markedly higher in non-neural tissues. These expression differences explain why neurons are selectively vulnerable to torsinA dysfunction: high levels of torsinB protect non-neuronal cells from the consequences of torsinA mutations, while neurons lack this compensatory mechanism. These findings demonstrate how tissue specificity in disease can result from differential susceptibility of cell types to disruptions in ubiquitous biological pathways .

What are the known transcript variants of the TOR1AIP1 gene?

Table 3: Characterized TOR1AIP1 Transcript Variants

SpeciesTranscriptGenBank IDKey FeaturesProtein Product
HumanVariant 1NM_00126757810 exons, includes CAG insertionLAP1B (longest isoform)
HumanVariant 2NM_01560210 exons, lacks CAG insertionLAP1B (shorter by 1 aa)
HumanESTDB454036Contains alternative exon 1bPutative alternative isoform
HumanESTCX760895Contains alternative exon 2bPutative alternative isoform
RatTranscript 1NM_14509210 exonsLAP1B
RatTranscript 2U20286Truncated exon 1 in N-terminalPutative LAP1C
RatTranscript 3U19614Skips exon 5Putative LAP1A

The TOR1AIP1 gene exhibits complex alternative splicing patterns that generate multiple transcript variants. In humans, bioinformatic analysis has identified 10 exons, with two confirmed transcript variants differing only by a CAG insertion that results in an additional alanine in the protein. The human gene also contains putative alternative exons (1b, 2b, 3b) identified through genomic alignments and EST evidence. In rats, three transcripts have been characterized: the full-length LAP1B and two variants likely corresponding to LAP1A and LAP1C. These transcript variants arise from mechanisms including alternative exon usage, exon skipping, and alternative splice site selection. The resulting protein isoforms likely serve specialized functions in different cellular contexts, contributing to the complex biological roles of LAP1 .

What are the most promising directions for future Tor1aip1 research?

Future research on Tor1aip1 should focus on several high-potential directions. First, detailed characterization of the mechanistic relationship between LAP1 and torsinA in maintaining nuclear envelope integrity would provide crucial insights into nuclear envelopathies. Second, exploration of LAP1's potential as a therapeutic target for muscular dystrophies and torsin-related disorders deserves attention, given its established role in these conditions. Third, further investigation of TOR1AIP1 as a cancer biomarker, particularly in kidney renal clear cell carcinoma, could yield valuable clinical applications. Finally, comprehensive characterization of tissue-specific isoform expression and function would enhance our understanding of LAP1's diverse biological roles. These research directions would significantly advance our knowledge of nuclear envelope biology and disease pathogenesis .

What technical challenges must be overcome in Tor1aip1 research?

Researchers face several technical challenges when studying Tor1aip1. The presence of multiple isoforms with subtle structural differences necessitates the development of highly specific antibodies and detection methods. The embryonic lethality of LAP1-null mice limits long-term studies, requiring conditional knockout approaches or alternative model systems. Distinguishing direct from indirect effects of LAP1 deficiency presents another challenge, as nuclear envelope disruption can trigger widespread cellular abnormalities. Furthermore, the functional redundancy among torsin family members complicates the interpretation of single-gene studies. Overcoming these challenges will require innovative experimental approaches combining advanced imaging techniques, sophisticated genetic manipulation, and systems biology perspectives to unravel the complex biology of LAP1 and its interacting partners .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.