Recombinant Mouse TPA-induced transmembrane protein homolog

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse TPA-induced Transmembrane Protein Homolog

Recombinant Mouse TPA-induced transmembrane protein homolog is a protein that is produced in vitro using an E. coli expression system . It is related to TPA (12-O-tetradecanoylphorbol-13-acetate), a tumor promoter extensively studied in mouse skin carcinogenesis models . TPA influences various signaling pathways, notably the Wnt/β-catenin pathway, which is critical in tumorigenesis .

TPA and the Wnt/β-Catenin Signaling Pathway

TPA enhances Wnt/β-catenin signaling by stabilizing casein kinase 1 (CK1ε) and increasing its kinase activity . This process induces the phosphorylation of LRP6 (lipoprotein receptor-related protein 6) and the formation of a CK1ε–LRP6–axin1 complex, leading to increased cytosolic β-catenin . TPA also promotes the interaction between β-catenin and TCF4E, which activates Wnt target genes .

ProteinEffect of TPA
CK1εStabilized by TPA, increased kinase activity
LRP6Phosphorylation induced by TPA at Thr1479 and Ser1490
β-cateninIncreased cytosolic levels and enhanced interaction with TCF4E
Axin1Forms complex with CK1ε and LRP6
TCF4EEnhanced interaction with β-catenin

Role in Neutrophil Extracellular Traps (NETs) Formation

TPA can stimulate neutrophils from ischemic mice to produce NETs, which are linked to brain hemorrhage after ischemic stroke . The formation of NETs is associated with increased expression of PAD4 (peptidylarginine deiminase 4) and the tPA receptor LRP-1 in neutrophils under ischemic conditions .

Experimental Findings

  • TPA-induced NET Formation: tPA treatment significantly increases H3Cit+ neutrophils and NET formation in ischemic mice compared to vehicle-treated mice .

  • PAD4 Involvement: tPA-treated neutrophils from ischemic mice show increased PAD4 expression, and inhibiting PAD reduces H3Cit+ neutrophils and NET formation .

  • LRP-1 Upregulation: tPA increases LRP-1 expression in the ischemic cortex, and inhibiting LRP-1 reduces neutrophil recruitment and NET formation in tPA-treated mice .

  • CK1ε/δ Stabilization: TPA increases the half-life of CK1ε and CK1δ proteins by inhibiting their degradation through the ubiquitin-proteasome system .

  • Subcellular Localization: TPA increases CK1ε and CK1δ protein levels in the membrane, nuclear, and cytoplasmic fractions of cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TPA-induced transmembrane protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-218
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MEEGSRSQSPREELELSMLDGPQEELTPLNNDLRIQPNSAEDPSPAQVGKESPWSPCNKS VVGKCKLWMVIVTIFLCFIIVIVISLCLVGVTYIDEDENEILELSSNKTFFITLKIPEEC ANEEGLHHLLTERLTDTYRQSPSLSRFFTSADILDFSVENATVTYHLQFGVPSEDDDFMK YMMSEELVLGIMRQSFHDKNISTCESLGLDPESLLLYE
Uniprot No.

Target Background

Database Links

KEGG: mmu:212998

UniGene: Mm.97511

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What are the primary transmembrane receptor interactions with recombinant mouse tPA in the central nervous system?

Recombinant mouse tPA primarily interacts with low-density lipoprotein receptor-related protein 1 (LRP-1), a key transmembrane receptor that mediates many of tPA's effects in the central nervous system . Studies have demonstrated that tPA-treated neutrophils from ischemic mice exhibit increased expression of LRP-1, suggesting a feedback mechanism in pathological conditions . The tPA-LRP1 interaction is crucial for long-term potentiation (L-LTP) in hippocampal neurons, as blocking LRP1 with receptor-associated protein (RAP) causes deficits in L-LTP similar to those observed in tPA-deficient mice .

Methodologically, researchers investigating these interactions should consider using:

  • Western blot analysis to measure LRP-1 expression changes

  • Immunostaining to confirm localization of LRP-1 after tPA treatment

  • Pharmacological inhibitors like RAP to block specific interactions

  • Gene knockout models (tPA⁻/⁻) to confirm specificity of effects

How do researchers distinguish between plasminogen-dependent and plasminogen-independent effects of recombinant mouse tPA?

Distinguishing between these mechanisms requires careful experimental design. Plasminogen-independent actions can be identified when tPA effects persist in plasminogen-deficient models or when catalytically inactive tPA (S478A) retains biological activity .

Methodologically, researchers should:

  • Use plasminogen-deficient (plg⁻/⁻) animal models alongside tPA⁻/⁻ models

  • Employ recombinant catalytically inactive tPA (S478A) which has a serine to alanine mutation at the active site

  • Utilize specific inhibitors: PAI-1 to inhibit tPA's proteolytic activity and α2-antiplasmin to block plasmin activity

  • Compare phenotypes between tPA⁻/⁻ and plg⁻/⁻ mice (non-matching phenotypes suggest plasminogen-independent mechanisms)

  • Conduct in vitro assays with purified components to directly assess proteolysis

What experimental models are most appropriate for studying recombinant mouse tPA effects on transmembrane signaling?

Selecting the appropriate experimental model is critical for valid results when studying tPA's effects on transmembrane signaling pathways.

Recommended models include:

  • In vivo: Photothrombotic middle cerebral artery occlusion (MCAO) models for stroke research

  • Intrahippocampal delivery systems for targeted tPA administration

  • Hippocampal slice preparations for electrophysiology studies examining synaptic transmission

  • Primary neuronal cultures for molecular signaling studies

  • Cell-specific conditional knockout models to isolate tPA effects in specific cell populations

For optimal results, researchers should consider both acute administration of recombinant tPA and genetic models (tPA⁻/⁻ mice) to comprehensively assess tPA's physiological roles.

What techniques should be used to examine recombinant mouse tPA-induced changes in neutrophil extracellular traps (NETs) and their impact on transmembrane barriers?

NETs have emerged as critical mediators of tPA-associated blood-brain barrier breakdown. Researchers investigating this phenomenon should employ a multi-faceted approach:

  • Quantification of NET markers: Measure histone H3 citrullination (H3Cit) using immunofluorescence and western blotting

  • Plasma DNA quantification: Elevated circulating DNA levels indicate NET formation in vivo

  • Ex vivo NET formation assays: Isolate neutrophils from experimental animals and assess their propensity to form NETs with or without tPA stimulation

  • Blood-brain barrier integrity assessment: Use in vitro BBB models to directly test the effects of NETs on barrier function

  • PAD4 expression analysis: Western blot for peptidylarginine deiminase 4, a critical enzyme for NET formation

  • Pharmacological interventions: Use DNase I to disrupt NETs or Cl-amidine to inhibit PAD activity

This comprehensive approach allows researchers to establish causality between tPA administration, NET formation, and BBB disruption.

How can researchers effectively investigate the cGAS-STING pathway in tPA-mediated effects on transmembrane barriers?

The cGAS-STING (cyclic GMP-AMP synthase-stimulator of interferon genes) pathway has been implicated in tPA-associated BBB breakdown. To investigate this pathway:

  • Use cGAS or STING knockout mice to determine pathway specificity

  • Employ selective cGAS inhibitors alongside tPA administration

  • Measure type I interferon responses downstream of STING activation

  • Assess BBB integrity using tracer molecules of different molecular weights

  • Perform immunohistochemistry to localize pathway components in the neurovascular unit

  • Use RNA sequencing to identify transcriptional changes in the interferon response following tPA treatment

This approach helps establish the mechanistic link between tPA administration, NET formation, cGAS-STING activation, and subsequent BBB disruption.

What are the recommended methods for studying the role of recombinant mouse tPA in synaptic plasticity and transmembrane receptor modulation?

Investigating tPA's role in synaptic plasticity requires specialized techniques focused on transmembrane receptor dynamics:

  • Electrophysiology: Record field potentials to measure long-term potentiation (L-LTP) in hippocampal slices with or without tPA

  • Pharmacological approach: Use GABA receptor antagonists like bicuculline or picrotoxin to unmask tPA effects on excitatory transmission

  • Synaptoneurosome preparation: Isolate synaptic fractions to study tPA's effects on synaptic vesicle cycling proteins

  • Phosphorylation studies: Monitor synapsin I phosphorylation to assess tPA's impact on presynaptic function

  • cAMP/PKA pathway analysis: Measure cAMP levels and PKA activity to determine downstream signaling events

  • BDNF cleavage assays: Assess tPA/plasmin-mediated conversion of proBDNF to mature BDNF

These methodologies enable detailed characterization of tPA's effects on synaptic function through both plasminogen-dependent and independent mechanisms.

How should researchers address experimental variability when studying recombinant mouse tPA effects on transmembrane signaling?

Experimental variability is a significant challenge in tPA research. To minimize variability:

  • Standardize recombinant tPA preparations: Use consistent sources and validate activity before experiments

  • Control for sex-specific effects: Analyze male and female animals separately as tPA effects may differ

  • Implement consistent surgical procedures: Standardize MCAO and other stroke models

  • Use appropriate controls: Include catalytically inactive tPA (S478A) as a control for non-proteolytic effects

  • Consider circadian effects: tPA activity shows diurnal variations

  • Age matching: Use age-matched animals as tPA effects change with development

  • Randomization and blinding: Implement these practices to minimize bias

Additionally, researchers should report detailed methodological parameters to improve reproducibility across laboratories.

What are the optimal approaches to isolate and characterize transmembrane proteins that interact with recombinant mouse tPA?

Isolating transmembrane protein interactors requires specialized techniques:

  • Cross-linking mass spectrometry (XL-MS): Identify direct protein-protein interactions

  • Co-immunoprecipitation: Pull down tPA and associated transmembrane proteins

  • Surface plasmon resonance: Determine binding kinetics of tPA with purified receptors

  • Proximity labeling techniques: Use BioID or APEX2 fused to tPA to identify proximal proteins in living cells

  • Receptor internalization assays: Track LRP1 endocytosis following tPA binding

  • Competitive binding assays: Use RAP to displace tPA from LRP1

  • Detergent selection: Carefully optimize detergent conditions to maintain transmembrane protein integrity

These approaches should be complemented with functional validation using genetic knockdown or pharmacological inhibition.

How does recombinant mouse tPA influence neurovascular coupling through transmembrane receptor modulation?

Neurovascular coupling, the link between neuronal activity and cerebral blood flow, appears to be modulated by tPA through several mechanisms:

  • NMDAR-nitric oxide signaling pathway: tPA may enhance this pathway to regulate vascular responses

  • Neuronal-astrocyte-vascular interface: Investigate tPA's effects across the neurovascular unit

  • Cerebral blood flow measurements: Use laser Doppler flowmetry or functional MRI to assess tPA's vascular effects

  • Transgenic approaches: Compare neurovascular coupling in tPA⁻/⁻ mice versus wild-type

  • Receptor-specific effects: Determine the role of LRP1 versus NMDA receptors in tPA's vascular actions

  • Age-dependent effects: Examine how tPA-mediated neurovascular coupling changes with aging or in models of Alzheimer's disease

This research area is particularly relevant for understanding tPA's therapeutic potential beyond thrombolysis in stroke and neurodegenerative conditions.

What methodological approaches are recommended for investigating tPA-induced changes in blood-brain barrier permeability?

The blood-brain barrier (BBB) is significantly impacted by tPA, contributing to hemorrhagic complications in stroke therapy. To study these effects:

  • In vitro BBB models: Use transwell systems with brain endothelial cells to measure tPA effects on barrier integrity

  • Evans Blue extravasation: Quantify BBB permeability in vivo following tPA administration

  • Immunohistochemistry: Assess tight junction protein expression and localization

  • Matrix metalloproteinase activity: Measure MMP activation following tPA treatment

  • Electron microscopy: Visualize ultrastructural changes in BBB components

  • NET inhibition strategies: Use DNase I or PAD4 inhibitors to determine NET contribution to BBB disruption

  • Inflammatory mediator profiling: Measure cytokine and chemokine responses that may mediate BBB effects

These approaches help elucidate the mechanisms by which tPA compromises BBB integrity, providing targets for reducing hemorrhagic complications in stroke therapy.

How can multi-omics approaches advance our understanding of recombinant mouse tPA effects on transmembrane signaling networks?

Multi-omics strategies offer powerful tools for comprehensively mapping tPA's effects:

  • Proteomics: Use TMT labeling to quantify changes in the brain proteome after tPA treatment

  • Phosphoproteomics: Identify signaling pathways activated by tPA through transmembrane receptors

  • Transcriptomics: Perform RNA-seq to identify gene expression changes following tPA administration

  • Metabolomics: Profile metabolic alterations induced by tPA signaling

  • Single-cell approaches: Characterize cell-specific responses to tPA

  • Network analysis: Integrate multi-omics data to identify key regulatory nodes

  • Temporal profiling: Map the evolution of tPA responses across multiple time points

These approaches can reveal unexpected tPA functions and identify novel therapeutic targets for modulating tPA signaling.

What considerations are important when designing experiments to study the intersection of recombinant mouse tPA with transmembrane proteins in Alzheimer's disease models?

Alzheimer's disease research presents unique challenges for tPA studies:

  • Model selection: Choose between amyloid-β models (e.g., Tg2576) or tau models based on research question

  • Age-dependent effects: Design longitudinal studies to capture tPA's changing role during disease progression

  • Regional specificity: Focus on brain regions most affected in Alzheimer's disease

  • Cell-type specificity: Determine whether tPA effects differ between neurons, astrocytes, and microglia

  • Amyloid-β clearance: Assess tPA's role in proteolytic degradation of Aβ

  • Vascular function: Measure neurovascular coupling deficits and tPA's potential to restore them

  • Behavioral assessment: Include cognitive testing to correlate biochemical findings with functional outcomes

These considerations are essential for understanding tPA's potential as a therapeutic target in Alzheimer's disease and other neurodegenerative conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.