Recombinant Mouse Trace amine-associated receptor 1 (Taar1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Mouse Trace Amine-Associated Receptor 1 (Taar1) is a genetically engineered form of the Taar1 receptor, a G protein-coupled receptor (GPCR) that modulates monoaminergic neurotransmission. It is expressed in presynaptic terminals of dopamine, norepinephrine, and serotonin neurons, where it regulates neurotransmitter release and reuptake via cAMP and PKC signaling pathways . Recombinant Taar1 is primarily used in vitro to study receptor-ligand interactions, signal transduction mechanisms, and species-specific pharmacological responses .

Key Phenotypes Associated with Taar1 Function

PhenotypeTaar1 GenotypeMA Intake (mg/kg/day)Hypothermia SensitivitySource
High MA consumptionNon-functional12.3 ± 1.4Reduced
Low MA consumptionFunctional3.8 ± 0.9Enhanced
MA-induced aversionFunctionalN/AEnhanced CTA response
  • CRISPR-Cas9 Knock-In Studies:

    • Replacing the non-functional Taar1 allele in MAHDR mice with the functional B6 allele reduced MA intake by 67% and restored sensitivity to MA-induced hypothermia .

    • Taar1 knockout (−/−) mice exhibited 3.2-fold higher MA consumption than wild-type (+/+) mice .

Ligand Efficacy and Species-Specific Responses

LigandMouse Taar1 EC₅₀ (nM)Human TAAR1 EC₅₀ (nM)Effect on MA IntakeSource
RO5263397 (partial agonist)0.715.4↓ 58%
β-Phenylethylamine55371↓ 42%
Methamphetamine12002800↑ 89% (in KO mice)
  • Species Divergence:

    • Mouse Taar1 responds robustly to trace amines (e.g., β-phenylethylamine, tyramine), while human TAAR1 requires higher ligand concentrations .

    • A single I290Y mutation in human TAAR1 increases potency for ulotaront by 100-fold, mimicking rodent pharmacology .

Mechanistic Role in Neurotransmission

  • Monoamine Regulation:

    • Functional Taar1 reduces dopamine neuron firing by activating GIRK channels, preventing hyper-dopaminergic states .

    • MA-induced dopamine efflux is amplified in Taar1 −/− mice due to impaired DAT internalization .

  • Thermal Response:

    • MAHDR mice (non-functional Taar1) show a 1.5°C smaller drop in body temperature post-MA compared to B6 mice .

Clinical and Therapeutic Implications

  • Addiction Vulnerability:

    • Non-functional Taar1 alleles correlate with higher MA self-administration in mice and potentially humans .

    • TAAR1 agonists like RO5263397 suppress MA self-administration by 58% in rats .

  • Psychiatric Disorders:

    • TAAR1 partial agonists show antidepressant-like effects in forced swim tests (↓ immobility by 37%) and improve DRL performance in primates .

Future Directions

  • Personalized Medicine: Screening for TAAR1 SNPs (e.g., D2-like non-functional alleles) could identify individuals at risk for stimulant addiction .

  • Drug Development: Structural insights from cryo-EM studies of hTAAR1-Gαs complexes may enable design of species-agnostic agonists .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Taar1; Ta1; Tar1; Trar1; Trace amine-associated receptor 1; TaR-1; Trace amine receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWL LHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDR YCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGG CSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQ SKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMV YAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL
Uniprot No.

Target Background

Function
Trace amine-associated receptor 1 (TAAR1) is a receptor for trace amines, including beta-phenylethylamine (b-PEA), p-tyramine (p-TYR), octopamine, and tryptamine. It exhibits the highest affinity for b-PEA and p-TYR. TAAR1 is unresponsive to classical biogenic amines, such as epinephrine and histamine, and only partially activated by dopamine and serotonin. Trace amines are biogenic amines present in very low levels in mammalian tissues. While some trace amines have clearly defined roles as neurotransmitters in invertebrates, their function as true neurotransmitters in vertebrates remains speculative. Trace amines are likely involved in various physiological functions yet to be fully understood. The signal transduced by this receptor is mediated by the G(s)-class of G-proteins which activate adenylate cyclase.
Gene References Into Functions
  1. Activation of TAAR1 potentiates methamphetamine-induced hypothermia, and TAAR1 confers sustained neuroprotection dependent on its thermoregulatory effects. PMID: 28919515
  2. The Taar1 gene is within a mouse chromosome 10 quantitative trait locus for methamphetamine consumption, and TAAR1 function determines sensitivity to the aversive effects of methamphetamine that may curb intake. PMID: 27055611
  3. Single nucleotide polymorphism (SNP)-induced changes in mouse TAAR1 function. PMID: 27031617
  4. Behavioral and physiological studies indicate that TAAR1 function increases sensitivity to the aversive effects of methamphetamine, potentially protecting against methamphetamine use. PMID: 25740289
  5. This study demonstrated that TAAR1 Modulates Cortical Glutamate NMDA Receptor Function in mice. PMID: 25749299
  6. This study reports that TAAR1 potentiates the degeneration of dopaminergic neurons and attenuates the behavioral response to l-DOPA and presynaptic and postsynaptic glutamate neurotransmission in the striatum. PMID: 26468205
  7. These data demonstrate supersensitivity of postsynaptic D2 dopamine receptors in the striatum of TAAR1-KO mice and indicate a close interaction between TAAR1 and D2 dopamine receptors. PMID: 25721394
  8. The data of this study indicated that apomorphine activity at TAAR1 contributes to some behavioral manifestations, particularly climbing. PMID: 24925023
  9. This study demonstrated Taar1-mediated modulation of presynaptic dopaminergic neurotransmission: role of D2 dopamine autoreceptors. PMID: 24565640
  10. These observations confirm the modulatory role of TAAR1 on monoamine activity and suggest that in vivo, the receptor is either constitutively active and/or tonically activated by ambient levels of endogenous agonists. PMID: 22763617
  11. Data show that TAARs were expressed only at trace amounts in most tissues, with exceptions being TAAR1 in the stomach and testis, and TAAR8a in the intestine, spleen, and testis. PMID: 22442117
  12. Data support that TAAR1 tonically activates inwardly rectifying K(+) channels, which reduces the basal firing frequency of dopamine neurons in the ventral tegmental area. PMID: 19892733
  13. Expression of neuronal trace amine-associated receptor (Taar) mRNAs in leukocytes. PMID: 17900709
  14. Trace amine-associated receptor 1 (TAAR1) activity decreases the spontaneous firing rate of dopaminergic neurons in the ventral tegmental area. PMID: 18083911
  15. Previous studies reported TAAR expression in the brain. This paper found TAAR expression only in olfactory epithelial cells, and each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines. PMID: 16878137
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Widely distributed throughout the brain. Strongly expressed in the mitral cell layer of the olfactory bulb, piriform cortex, the arcuate, motor, and mesencephalic trigeminal nuclei, lateral reticular and hypoglossal nuclei, cerebellar Purkinje cells, and

Q&A

What is TAAR1 and where is it expressed in mice?

TAAR1 is a G-protein-coupled receptor that responds to low-abundance, endogenous amines such as tyramine, β-phenethylamine, octopamine, and tryptamine, which are metabolites of amino acids with structural similarity to biogenic amines . In mice, TAAR1 shows a restricted peripheral distribution with expression primarily in pancreatic islets (specifically co-localized with insulin in β-cells), the duodenum and jejunum of the small intestine, and the pylorus of the stomach . TAAR1 is also expressed in specific brain regions where it modulates monoaminergic neurotransmission . Additionally, TAAR1 has been detected at low levels in the heart, where it may regulate cardiovascular tone, and is expressed on lymphocytes and astrocytes involved in inflammation and response to infection .

How does mouse TAAR1 signal upon activation?

Upon activation, mouse TAAR1 primarily signals via Gαs proteins, leading to increased intracellular cAMP levels . This signaling can be measured using either cAMP assays or beta-lactamase reporter assays in expression systems such as HEK-293/CRE-bla cells . The signaling response is typically robust in mouse TAAR1 compared to human TAAR1 when exposed to trace amines . In pancreatic β-cells, TAAR1 activation potentiates glucose-dependent insulin secretion through this cAMP pathway, similar to the effect of established insulin secretagogues like Exendin-4 .

What are the primary differences between mouse and human TAAR1?

Mouse and human TAAR1 exhibit distinct pharmacological properties. In expression systems, mouse TAAR1 shows a more robust response to trace amines compared to human TAAR1, which demonstrates a weaker, albeit measurable, response . This species difference extends to the pharmacological profile of agonists, as examination of various agonists has revealed that human and chimaeric human-mouse receptors share almost identical pharmacology but differ significantly from the mouse receptor . Additionally, the EC50 values for the selective TAAR1 agonist RO5166017 vary considerably between species: 55 nM for human TAAR1, 14 nM for rat TAAR1, and 3 nM for mouse TAAR1, demonstrating higher potency in mouse receptors .

What genetic variations of mouse TAAR1 are known to affect function?

A significant genetic variation in mouse TAAR1 is a non-synonymous single nucleotide polymorphism (SNP) in the DBA/2J mouse strain, which encodes a missense proline (CCC) to threonine (ACC) mutation at position 229 in the second transmembrane domain of the TAAR1 protein . This mutant allele, named Taar1m1J, produces a receptor that does not respond to methamphetamine or endogenous agonists, effectively eliminating TAAR1 function . By contrast, the C57BL/6 (B6) mouse strain and at least 27 other inbred strains, including four wild-derived strains, express the functional allele . The functional consequences of this polymorphism include predisposition to high methamphetamine intake in DBA/2J mice compared to C57BL/6 mice .

What are the optimal expression systems for recombinant mouse TAAR1?

For successful expression and characterization of recombinant mouse TAAR1, HEK (human embryonic kidney)-293/CRE-bla cells have proven effective . When expressing human TAAR1, which is more challenging to express functionally, creating chimaeric receptors where certain fragments of human TAAR1 are replaced with corresponding regions of mouse TAAR1 has resulted in much stronger responses in cAMP production . Alternative expression systems include SF9 insect cells using baculovirus vectors, which have been successfully employed for immunofluorescence validation of TAAR1 antibodies . When designing expression constructs, it is important to consider that some members of the TAAR subfamily remain difficult to express and characterize using recombinant systems . Optimizing expression conditions, including temperature, time of expression, and cellular compartmentalization factors, may improve functional expression levels.

How can researchers effectively measure TAAR1 activation in experimental settings?

Several complementary approaches can be used to measure TAAR1 activation. The most common methods include cAMP accumulation assays, which directly measure the increase in intracellular cAMP levels following TAAR1 activation via Gαs signaling . Beta-lactamase reporter assays in HEK-293/CRE-bla cells offer another sensitive approach for detecting TAAR1 activation . For functional studies in pancreatic β-cells, glucose-dependent insulin secretion assays can be performed in cell lines like INS1E or in isolated pancreatic islets, comparing the effects of TAAR1 agonists at low (2 mM) versus high (16 mM) glucose concentrations . When investigating TAAR1 function in vivo, researchers can measure physiological endpoints such as oral glucose tolerance, plasma PYY and GLP-1 levels, insulin sensitivity, body weight changes, and food intake in response to TAAR1 agonist administration . Controls should include both positive controls (known TAAR1 agonists like RO5166017) and negative controls (vehicle or compounds known not to activate TAAR1).

What strategies exist for developing selective ligands for mouse TAAR1?

Development of selective TAAR1 ligands requires screening approaches that account for species differences in receptor pharmacology. Small molecule libraries of pharmacologically active agents have been successfully screened to identify synthetic agonists for TAAR1 . Interestingly, some identified TAAR1 agonists are also ligands of the enigmatic imidazoline receptor, suggesting potential structural similarities in binding domains . For structure-activity relationship studies, researchers should test compounds across multiple species variants of TAAR1 (mouse, rat, human) to account for pharmacological differences . The selective small molecule TAAR1 agonist RO5166017 activates human, rat, and mouse TAAR1 with different potencies (EC50s of 55, 14, and 3 nM, respectively) , making it a valuable tool compound for comparative studies. When developing new ligands, researchers should assess selectivity against other aminergic receptors, especially monoamine receptors that share structural similarities with TAAR1.

How can genetic variations in TAAR1 be leveraged for studying receptor function?

The naturally occurring genetic variation in mouse TAAR1 (the Taar1m1J allele in DBA/2J mice) provides a valuable tool for studying TAAR1 function . Comparing behavioral, physiological, and pharmacological responses between C57BL/6 mice (functional TAAR1) and DBA/2J mice (non-functional TAAR1) can reveal TAAR1-dependent effects. The B6XD2 (BXD) family of recombinant inbred (RI) strains offers another genetic approach, though researchers should be aware that BXD strains derived 30-40 years ago express only the functional B6 Taar1 allele, whereas some more recently derived BXD RI strains express the non-functional D2 allele . This discrepancy indicates the D2 mutation arose subsequent to the derivation of the original RIs. For more controlled studies, Taar1 knockout mice that express the LacZ gene under control of the Taar1 promoter (Taar1−/−/LacZ) enable both functional studies of TAAR1 deficiency and visualization of TAAR1 expression patterns through LacZ staining .

How does TAAR1 contribute to metabolic regulation and diabetes models?

TAAR1 functions as a novel integrator of metabolic control by acting on gastrointestinal and pancreatic islet hormone secretion . In pancreatic β-cells, TAAR1 activation by selective agonists increases glucose-dependent insulin secretion, similar to the effects of established diabetes drugs that work through the incretin pathway . Beyond insulin secretion, TAAR1 activation elevates plasma PYY and GLP-1 levels in mice, suggesting effects on multiple gut hormone systems that regulate appetite and glucose homeostasis . In diabetic db/db mice, TAAR1 agonism normalizes glucose excursion during oral glucose tolerance tests, demonstrating therapeutic potential in disease models . For metabolic disease research, appropriate models include diet-induced obese (DIO) mice, in which sub-chronic treatment with TAAR1 agonists reduces food intake, body weight, and plasma triglyceride levels while improving insulin sensitivity . When designing studies to evaluate TAAR1's metabolic effects, researchers should include comprehensive analyses of glucose tolerance, insulin secretion, gut hormone levels, food intake, body weight, insulin sensitivity, and lipid metabolism.

What is the role of TAAR1 in addiction and substance use disorder models?

TAAR1 plays a significant role in addiction and substance use disorder models, particularly for methamphetamine (MA) . Taar1 knockout mice orally self-administer more MA than wild-type and are insensitive to its aversive effects, indicating TAAR1's involvement in limiting drug consumption . The DBA/2J mouse strain, which expresses the non-functional Taar1m1J allele, is predisposed to high MA intake compared to C57BL/6 mice with functional TAAR1 . TAAR1's mechanism in addiction involves modulation of dopamine neurotransmission, as TAAR1 stimulation reduces synaptic dopamine availability and alters glutamatergic function in the brain . For studying TAAR1's role in addiction, researchers can employ various behavioral paradigms, including drug self-administration, conditioned place preference/aversion, and drug discrimination. Comparing responses in wild-type, Taar1 knockout mice, and mice with natural TAAR1 polymorphisms can reveal the receptor's contribution to addictive behaviors. Additionally, combining behavioral approaches with neurochemical measurements (microdialysis, fast-scan cyclic voltammetry) can elucidate the underlying mechanisms of TAAR1's effects on dopamine and glutamate systems.

How can TAAR1 be targeted for neuropsychiatric disorders?

TAAR1 has been implicated in various neuropsychiatric conditions, including schizophrenia, depression, and migraine . In the brain, TAAR1 modulates monoaminergic neurotransmission in restricted areas, making it a promising target for psychiatric disorders . The development of selective TAAR1 ligands has enabled exploration of specific TAAR1 activation in these conditions . For neuropsychiatric research, appropriate models include behavioral tests relevant to schizophrenia (prepulse inhibition, locomotor responses to psychostimulants), depression (forced swim test, tail suspension test, sucrose preference), and anxiety (elevated plus maze, open field test). Neurochemical approaches to assess monoamine neurotransmission, such as in vivo microdialysis or electrophysiological recordings of monoaminergic neurons, can provide mechanistic insights. Additionally, investigating interactions between TAAR1 ligands and established psychiatric medications may reveal potential adjunctive therapeutic approaches.

What are the main difficulties in establishing stable expression of recombinant mouse TAAR1?

Establishing stable expression of recombinant TAAR1 presents several challenges. Some members of the TAAR subfamily remain difficult to express and characterize using recombinant systems . Human TAAR1 typically shows weaker responses compared to mouse TAAR1, suggesting expression or coupling efficiency issues . To overcome these challenges, researchers have successfully created chimaeric receptors by replacing certain fragments of human TAAR1 with corresponding regions of mouse TAAR1, resulting in much stronger responses in cAMP production while maintaining human-like pharmacology . For antibody validation and expression verification, immunofluorescence techniques using HEK293 cells expressing recombinant human TAAR1 N-terminus/extracellular domain constructs fused to His tag or SF9 cells expressing full-length human TAAR1 from baculovirus vectors have proven effective . When designing expression constructs, careful consideration of signal peptides, N-terminal tags, and codon optimization may improve expression levels. Additionally, culture conditions, including temperature and time of expression, can significantly impact functional receptor levels.

How can researchers overcome species differences when studying TAAR1 pharmacology?

Species differences in TAAR1 pharmacology present significant challenges for translational research . To address this issue, researchers should employ a multi-species approach, testing compounds on human, mouse, and rat TAAR1 in parallel. Creating chimaeric receptors by replacing certain fragments of human TAAR1 with corresponding regions of mouse TAAR1 has proven effective for expression while maintaining human-like pharmacology . For pharmacological characterization, using standardized assay platforms across species (such as cAMP accumulation assays in HEK293 cells) enables direct comparisons of potency and efficacy . When developing selective ligands, screening approaches should include counter-screening against other species variants to identify compounds with consistent cross-species activity or to characterize species-specific effects. Understanding structural determinants of species differences through site-directed mutagenesis and molecular modeling can provide insights into key residues governing ligand recognition and receptor activation.

What methods are optimal for detecting TAAR1 expression in native tissues?

Detecting TAAR1 expression in native tissues requires sensitive and specific methods due to relatively low expression levels . Immunohistochemistry using validated mouse monoclonal antibodies against human TAAR1 has successfully revealed TAAR1 distribution in peripheral tissues including pancreatic islets, duodenum, jejunum, and pylorus of the stomach . For co-localization studies, double immunofluorescence staining can determine cellular specificity, such as the co-localization of TAAR1 with insulin in pancreatic β-cells but not with glucagon . At the mRNA level, quantitative real-time PCR (qRT-PCR) with specific DNA primers can detect TAAR1 expression relative to housekeeping genes like GAPDH . For mouse studies, Taar1 knockout mice expressing the LacZ gene under control of the Taar1 promoter (Taar1−/−/LacZ) enable visualization of TAAR1 expression patterns through LacZ staining . Control experiments should include secondary antibody only and pre-absorption controls with the immunogen to ensure specificity . For comprehensive tissue profiling, systematic analysis across multiple tissues with appropriate positive controls (known TAAR1-expressing tissues) and negative controls (tissues known not to express TAAR1, such as heart, kidney, and liver) is essential .

How might understanding genetic polymorphisms in TAAR1 advance personalized medicine?

Genetic polymorphisms in both mouse and human TAAR1 significantly affect receptor function, with implications for personalized medicine approaches . In humans, SNPs in TAAR1 alter its function, resulting in expressed receptors with varying degrees of functionality: fully functional, sub-functional, and non-functional variants . These functional differences likely contribute to individual susceptibility to conditions associated with TAAR1, including obesity, schizophrenia, depression, fibromyalgia, migraine, and addiction . Future research should focus on comprehensive genetic screening of TAAR1 variants in diverse human populations, followed by functional characterization of identified polymorphisms in recombinant expression systems. Correlating specific TAAR1 genotypes with clinical phenotypes could identify patient subgroups more likely to respond to TAAR1-targeted therapies or with different risk profiles for TAAR1-associated conditions. Additionally, developing allele-specific compounds that can effectively target variant receptors could enable truly personalized therapeutic approaches for individuals with different TAAR1 genotypes.

What emerging technologies could enhance TAAR1 research?

Several emerging technologies hold promise for advancing TAAR1 research. CRISPR-Cas9 gene editing enables precise modification of the Taar1 gene in various model systems, allowing creation of specific polymorphisms, conditional knockouts, or reporter knock-ins. Single-cell RNA sequencing can reveal cell type-specific expression patterns of TAAR1 and co-expressed genes across tissues, providing insights into potential functional networks. Advanced structural biology approaches, including cryo-electron microscopy of TAAR1 alone or in complex with signaling partners, could elucidate the three-dimensional structure of the receptor in different activation states, informing structure-based drug design. Chemogenetic and optogenetic tools targeting TAAR1-expressing cells would enable precise spatial and temporal control over receptor activity in vivo. Metabolomic profiling of endogenous trace amines and related compounds across tissues, disease states, and genetic backgrounds could identify physiological conditions that modulate TAAR1 signaling. Integration of these technologies with computational approaches, including systems biology modeling and artificial intelligence-driven drug design, could accelerate development of novel TAAR1-targeted therapeutics with improved selectivity and efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.