Recombinant Mouse Trace amine-associated receptor 2 (Taar2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

TAAR2 is a member of the trace amine-associated receptor family, primarily expressed in olfactory epithelium, limbic brain regions (e.g., hippocampus, hypothalamus), and leukocytes . It regulates dopamine levels, neurogenesis, and electrophysiological activity in the brain . Recombinant TAAR2 refers to a synthetic, laboratory-produced version of this receptor, engineered for functional studies in vitro.

Applications in Research

Recombinant TAAR2 is utilized to study:

  1. Ligand Binding: Testing interactions with trace amines (e.g., β-phenylethylamine, tyramine) and synthetic compounds .

  2. Signaling Pathways: Investigating G-protein coupling and downstream cAMP or calcium signaling .

  3. Disease Modeling: Exploring links to schizophrenia and bipolar disorder, where TAAR2 mutations are implicated .

Table 1: Potential Applications of Recombinant TAAR2

ApplicationDescriptionRelevance
Ligand ScreeningHigh-throughput assays to identify agonists/antagonists.Drug discovery for neuropsychiatric disorders.
Structural StudiesCryo-EM or X-ray crystallography to resolve receptor conformation.Understanding ligand-receptor interactions.
Functional AssaysMeasuring cAMP production or calcium mobilization in response to ligands.Validating receptor activity.

Challenges and Considerations

  1. Signal Transduction: TAAR2’s exact G-protein coupling mechanism remains unclear, requiring functional assays with recombinant proteins .

  2. Species Specificity: Mouse TAAR2 may differ structurally from human TAAR2, necessitating cross-species validation .

  3. Stability: Repeated freezing/thawing degrades the protein, requiring careful handling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Taar2; Gm225; Gpr58; Trace amine-associated receptor 2; TaR-2; Trace amine receptor 2; mTaar2; G-protein coupled receptor 58
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MASFEAQQETFDCSEYGNGSCPENERSLGVRAAMYSLMACAIFITIFGNLAMIISISYFK QLHTPTNLLILSMAVTDFLLGFTIMPYSMVRSVENCWYFGLTFCKIHYSFDLMLSITSIF HLCSVAVDRFYAICHPLHYCTKMTIPVVRRLLLVCWSVPGAFAFGVVFSEAYADGIEGYD ILVACSSSCPVMFNKLWGTTLFVAGFFTPSSMMVGIYGKIFAVSKKHARVIDNLPENQNN QMRKDKKAAKTLGIVMGVFLLCWFPCFFTILLDPFLNFSTPAVLFDALTWFGYFNSTCNP LIYGFFYPWFRRALKYILLGKIFSSHFHNTNLFTQKETE
Uniprot No.

Target Background

Function
Orphan olfactory receptor specific for trace amines.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in neurons of the olfactory epithelium.

Q&A

Basic Research Questions

  • What is the expression pattern of mouse TAAR2 in the brain?

    TAAR2 is expressed beyond the olfactory system, with significant expression in limbic brain areas. Using β-galactosidase (LacZ) staining in TAAR2-KO mice with LacZ reporter insertion, researchers have identified TAAR2 expression in multiple brain regions including:

    • Glomerular and inner layers of the olfactory bulb

    • Piriform cortex

    • Hippocampus (particularly CA1 layer)

    • Hypothalamus

    • Lateral habenula

    • Raphe nuclei

    • Somatosensory cortex (layer 5)

    • Cerebellum

    LacZ staining showed that TAAR2 is not limited to olfactory neurons but is present in limbic brain areas that receive olfactory input, suggesting broader neurological functions .

  • How is TAAR2 knockout verified in mouse models?

    TAAR2 knockout (TAAR2-KO) verification typically involves multiple complementary techniques:

    • Genetic verification: PCR-based genotyping using primers specific to both wild-type and knockout alleles. The knockout gene typically shows a 400 bp band, while the wild-type gene shows a 200 bp band .

    • mRNA confirmation: RT-PCR to detect the presence of TAAR2 mRNA in tissues such as olfactory epithelium and olfactory bulb. While mRNA is detected in wild-type mice, it should be absent in TAAR2-KO mice .

    • Reporter gene expression: When using LacZ reporter gene insertion, β-galactosidase activity confirms the site of TAAR2 promoter activity. This allows visualization of where TAAR2 would normally be expressed .

    • qPCR quantification: Real-time PCR to measure expression levels across brain regions, comparing wild-type mice with TAAR2-KO mice to verify complete absence of TAAR2 expression .

  • What behavioral phenotypes are observed in TAAR2 knockout mice?

    TAAR2-KO mice display several distinct behavioral phenotypes compared to wild-type mice:

    • Increased locomotor activity: Significantly higher horizontal activity during 120-minute assessments [F(1,34) = 5.843, p = 0.021] .

    • Normal exploratory behavior: No difference in initial 5-minute exploration or distance traveled in open field tests .

    • Unchanged anxiety levels: Similar performance in elevated plus-maze tests with no difference in time spent in open arms .

    • Antidepressant-like behavior: Less immobility time in the forced swimming test, suggesting resistance to behavioral despair .

    • Normal pain perception: No significant differences in hot plate test reactions .

    These findings suggest TAAR2 may play roles in locomotor regulation and mood-related behaviors without affecting anxiety or exploratory behaviors.

  • How does TAAR2 differ structurally from other TAARs?

    The TAAR family shares structural similarities as G protein-coupled receptors, but TAAR2 has specific features:

    • TAAR2 contains a large number of extracellular leucine-rich repeats (LRRs) .

    • Like other TAARs, TAAR2 has seven transmembrane domains with specific binding residues that determine ligand specificity.

    • Key binding residues in TAAR proteins generally include conserved aspartate residues (D3.32) in transmembrane domain 3, which are crucial for amine binding .

    • Species differences in TAAR2 sequence, particularly in transmembrane domains 6 and 7, may contribute to differences in ligand recognition and binding properties .

    • Unlike TAAR1, which has well-established endogenous ligands, the specific natural ligands for TAAR2 are less well-characterized, though its structure predicts high affinity for primary amines .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.