Recombinant Mouse Trace amine-associated receptor 3 (Taar3)

Shipped with Ice Packs
In Stock

Description

Functional Role and Ligand Specificity

Taar3 is a specialized olfactory receptor that detects volatile amines, influencing aversive behaviors and odor discrimination.

Key Ligands and Sensitivity

Taar3 exhibits distinct ligand affinities, as demonstrated in in vivo and in vitro studies:

LigandDetection ThresholdBehavioral ImpactSource
Isopentylamine~10⁻⁹ MAversion in mice; olfactory detection
Phenylethylamine~10⁻⁶ MSecondary response (lower affinity than Taar4)
Trimethylamine~10⁻⁶ MActivation at higher concentrations
IsobutylamineNot quantifiedSexual behavior modulation in male mice

Taar3’s sensitivity to isopentylamine is critical for setting detection thresholds in mice, with a 6.3-fold reduction in sensitivity observed in Taar3 knockout mice .

Experimental Applications

Taar3 is utilized in neurobiology, behavioral studies, and drug discovery:

Behavioral Studies

  • Aversion Assays: Taar3 mediates aversive responses to isopentylamine, a volatile amine linked to predator scent .

  • Olfactory Discrimination: Taar3-specific glomeruli in the olfactory bulb show calcium-dependent activation at low ligand concentrations, enabling precise odor detection .

Pharmacological Research

  • Receptor-Ligand Dynamics: Recombinant Taar3 is used to study cAMP signaling pathways activated by trace amines, such as 3-iodothyronamine .

  • Species-Specific Insights: Unlike humans (where TAAR3P is a pseudogene), functional Taar3 in mice enables comparative studies on olfactory evolution .

Comparative Analysis of TAAR Subtypes

Taar3’s functional profile contrasts with related receptors:

ReceptorPrimary LigandSensitivity (EC₅₀)Behavioral Role
Taar3Isopentylamine7.9 × 10⁻⁷ MAversion detection
Taar4Phenylethylamine4.7 × 10⁻⁷ MAversion detection
Taar5Trimethylamine3.1 × 10⁻⁸ MHigh-affinity odor detection

Taar3 and Taar4 share partial ligand overlap (e.g., phenylethylamine), but Taar5 exhibits superior sensitivity to trimethylamine .

Research Challenges and Future Directions

  • Endogenous Ligands: While trace amines (e.g., β-phenylethylamine) are known, additional endogenous ligands remain elusive .

  • Species Variability: Human TAAR3P pseudogene status limits direct translational relevance, necessitating cross-species comparisons .

  • Therapeutic Potential: Taar3’s role in aversion may inform treatments for drug-seeking behaviors, though functional studies are required .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Taar3; Trace amine-associated receptor 3; TaR-3; Trace amine receptor 3; mTaar3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Taar3
Target Protein Sequence
MDLIYIPEDLSSCPKFGNKSCPPTNRSFRVRMIMYLFMTGAMVITIFGNLVIIISISHFK QLHSPTNFLILSMATTDFLLGFVIMPYSMVRSVESCWYFGDSFCKFHASFDMMLSLTSIF HLCSIAIDRFYAVCDPLHYTTTMTVSMIKRLLAFCWAAPALFSFGLVLSEANVSGMQSYE ILVACFNFCALTFNKFWGTILFTTCFFTPGSIMVGIYGKIFIVSRRHARALSDMPANTKG AVGKNLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDPYLDYSTPIIVLDLLVWLGYF NSTCNPLIHGFFYPWFRKALQFIVSGKIFRSNSDTANLFPEAH
Uniprot No.

Target Background

Function
Trace amine-associated receptor 3 (Taar3) is an olfactory receptor activated by several primary trace amines, including isoamylamine. It is activated by isoamylamine and cyclohexylamine, but not by the corresponding alcohols, isoamylalcohol and cyclohexanol. This receptor is likely mediated by the G(s)-class of G-proteins, which activate adenylate cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in neurons of the olfactory epithelium.

Q&A

What is mouse Trace amine-associated receptor 3 (Taar3)?

Mouse Trace amine-associated receptor 3 (Taar3) is a G protein-coupled receptor encoded by the Taar3 gene. It belongs to the trace amine-associated receptor family that responds to trace amines, which are biogenic amines present in very low concentrations in mammalian tissues. The full-length mouse Taar3 protein consists of 343 amino acids (1-343aa) and has a UniProt ID of Q5QD16 . Structurally, Taar3 contains the characteristic seven-transmembrane domain architecture typical of GPCRs, with sequences suited for ligand binding and G-protein coupling. The receptor is involved in detecting trace amines and potentially other volatile compounds, contributing to chemosensory functions.

How does mouse Taar3 compare structurally and functionally to its homologs in other species?

Evolutionary analyses have revealed that Taar3 has undergone different selective pressures across mammalian lineages. In primates, TAAR3 shows evidence of relaxed functional constraint in several lineages, with open reading frame (ORF) disruptions in humans and some other primates, suggesting pseudogenization events . Comparative studies indicate that branches with intact Taar3 ORFs evolve at rates consistent with purifying selection (ω₀ = 0.128), while pseudogenized lineages evolve at rates approaching neutral evolution (ωψ = 0.878) . Functionally, mouse Taar3 shows marginal activity in reporter gene assays, suggesting that the currently identified agonistic volatile amines may not be its natural ligands . This contrasts with the functionality in other species, indicating potential differences in ligand specificity or signaling efficiency across evolutionary lineages.

What are the optimal conditions for reconstituting lyophilized recombinant mouse Taar3 protein?

For optimal reconstitution of lyophilized recombinant mouse Taar3 protein, the following methodology is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the standard recommendation) to enhance stability

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

This approach minimizes protein degradation and maintains structural integrity for downstream applications . It is important to avoid repeated freeze-thaw cycles, as these can significantly compromise protein stability and functionality. For working solutions, aliquots can be stored at 4°C for up to one week.

How can researchers effectively express functional mouse Taar3 in heterologous systems?

Expressing functional mouse Taar3 in heterologous systems presents several challenges due to its membrane protein nature. Based on successful expression strategies:

  • Expression System Selection:

    • E. coli systems work well for producing recombinant protein for structural studies

    • For functional studies, mammalian expression systems (HEK293, CHO) are preferable to maintain proper folding and post-translational modifications

  • Vector Design Considerations:

    • Include an N-terminal signal sequence to direct proper membrane insertion

    • Consider fusion tags (His, FLAG) positioned to avoid interference with ligand binding domains

    • Codon optimization for the host system can improve expression levels

  • Expression Conditions:

    • For mammalian systems, transfection efficiency can be optimized using lipid-based transfection reagents

    • Temperature reduction post-induction (to 30°C) can improve proper folding

    • Co-expression with molecular chaperones may enhance functional expression

  • Functional Validation:

    • Employ cAMP accumulation assays or CRE-SEAP reporter gene assays to confirm receptor functionality

    • Studies indicate that mouse Taar3 shows marginal activity in CRE-SEAP reporter gene assays , suggesting careful optimization is needed

What methodologies are most effective for identifying and validating Taar3 ligands?

For effective identification and validation of Taar3 ligands, a multi-stage approach is recommended:

  • Primary Screening Methodologies:

    • cAMP accumulation assays (Taar3 primarily couples to Gαs)

    • CRE-SEAP reporter gene assays, though these have shown marginal activity for mouse Taar3

    • Calcium mobilization assays with promiscuous G proteins (Gα15/16)

    • Membrane potential assays using voltage-sensitive dyes

  • Validation and Characterization:

    • Dose-response curves to determine EC50 values

    • Competition binding assays with radiolabeled or fluorescent ligands

    • Receptor internalization assays to measure receptor trafficking

    • Real-time label-free cellular assays (e.g., impedance-based systems)

  • Structural Insights:

    • Homology modeling based on related GPCR crystal structures

    • Molecular docking of potential ligands

    • Site-directed mutagenesis of predicted binding pocket residues

  • Technical Considerations:

    • Surface expression verification via immunofluorescence or ELISA

    • Control experiments with known GPCR ligands to confirm assay functionality

    • Comparison with results from related TAARs to identify family-specific patterns

Researchers should note that current evidence suggests the identified agonistic volatile amines at Taar3 may not be the natural ligands , indicating the need for broad screening approaches.

What is the evidence for pseudogenization of Taar3 in certain species, and how does this inform functional studies?

Evidence for Taar3 pseudogenization comes from evolutionary analyses across mammalian species, particularly in primates:

  • Genomic Evidence:

    • Open reading frame (ORF) disruptions have been identified in TAAR3 genes in multiple primate lineages

    • Statistical models strongly favor differential selective pressures between lineages with intact ORFs versus disrupted ones

  • Evolutionary Rate Analysis:

    • Branches with intact Taar3 ORFs evolve under purifying selection (ω₀ = 0.128)

    • Pseudogenized lineages show evolutionary rates approaching neutral evolution (ωψ = 0.878)

    • Statistical models support that lineages with ORF disruptions acquired in ancestral branches (ψ1) evolve at rates not significantly different from 1, consistent with neutral evolution

  • Cross-Species Functionality:

    • Mouse and rat Taar3 show marginal activity in functional assays

    • Cow Taar3 and primate Taar3 exhibit non-functionality

This evidence has important implications for functional studies:

  • Researchers should be cautious when extrapolating findings across species

  • The marginal or absent functionality in multiple species suggests that identified volatile amines may not be the natural ligands for Taar3

  • Species-specific differences should be considered when designing experiments

  • Comparative studies with functional and non-functional orthologs can help identify critical residues for ligand binding and receptor activation

The table below summarizes key statistical findings regarding evolutionary models of TAAR3:

Hypothesis testedωP-value
ω₀≠ωψω₀ = 0.128, ωψ = 0.878<0.0001
ω₀, ωψ≠1ω₀ = 0.128, ωψ = 10.5967
ω₀≠ωψ, ωψ≠ωψ1≠ωψ2ω₀ = 0.128, ωψ1 = 2.915, ωψ2 = 0.7010.0444
ω₀, ωψ1≠1, ωψ2ω₀ = 0.128, ωψ1 = 1, ωψ2 = 0.6990.1089

These values demonstrate that intact Taar3 lineages evolve under purifying selection, while pseudogenized lineages evolve at rates consistent with neutral evolution .

How does the evolutionary history of Taar3 compare with other trace amine-associated receptors?

The evolutionary history of Taar3 reveals interesting patterns when compared with other trace amine-associated receptors, particularly TAAR4 and TAAR5:

  • Patterns of Pseudogenization:

    • TAAR3 and TAAR4 show significant overlap in pseudogenization events across primate species, particularly in apes and Callithrichinae

    • Statistical analysis confirms this correlation (Fisher's exact test, P = 0.01), suggesting potentially related functions

    • In contrast, TAAR5 pseudogenization does not correlate with either TAAR3 or TAAR4 (P = 1)

  • Evolutionary Rate Correlation:

    • TAAR3 and TAAR4 show significant correlation in their evolutionary rates across primate lineages (Spearman's rank rs = 0.4870, P = 0.0252)

    • No significant correlation exists between TAAR3-TAAR5 or TAAR4-TAAR5

    • This suggests that TAAR3 and TAAR4 experience similar selective pressures, supporting a hypothesis of functional similarity

  • Evidence for Positive Selection:

    • Unlike TAAR4, no evidence of positive selection was found for TAAR3 in primates or other mammals

    • TAAR5 shows evidence of positively selected sites among non-primate mammals

    • This suggests different evolutionary trajectories: TAAR3 either maintained its ancestral function or lost function, while TAAR4 may have adapted to new functions in some lineages

  • Conservation Patterns:

    • TAAR5 is generally more conserved across species than TAAR3 and TAAR4

    • This suggests TAAR5 may serve a more fundamental or essential biological role

These comparative patterns provide valuable context for mouse Taar3 research, suggesting that:

  • Functional studies should consider potential overlap or complementarity with Taar4

  • The evolutionary conservation patterns suggest caution when extrapolating mouse models to human biology

  • The lack of positive selection in Taar3 argues against frequent changes in agonist profiles within primates

What statistical models best explain the evolutionary dynamics of Taar3 across mammalian species?

Statistical modeling of Taar3 evolution across mammalian species has provided important insights into its evolutionary dynamics:

  • Model Comparison Approach:

    • Various nested models were tested using likelihood ratio tests (LRTs)

    • Models were evaluated for how well they explain the patterns of sequence evolution observed in TAAR3 genes across species

  • Key Findings from Model Comparisons:

    • A model in which lineages with ORF disruptions have different evolutionary rates (ω) compared to lineages with intact ORFs is strongly favored for TAAR3 (P < 0.0001)

    • Lineages with intact ORFs evolve under purifying selection (ω₀ = 0.128)

    • Pseudogenized lineages evolve at rates approaching neutral evolution (ωψ = 0.878)

  • Refined Models of Pseudogenization:

    • When distinguishing between branches that inherited pseudogenization from ancestors (ψ1) versus those where pseudogenization occurred along the branch (ψ2), a more complex pattern emerges

    • ψ1 lineages evolve at rates not significantly different from neutral evolution (ω = 1)

    • ψ2 lineages show intermediate rates (ωψ2 = 0.699)

  • Absence of Positive Selection:

    • Unlike some other genes, no evidence was found for positive selection acting on specific sites in primate TAAR3

    • This argues against frequent adaptive changes in agonist response within primates

These statistical findings have important implications for experimental design:

  • When using mouse models, researchers should be aware that the functional constraints on Taar3 differ across lineages

  • The null hypothesis of neutral evolution for pseudogenized lineages provides a framework for interpreting sequence variation

  • The lack of positive selection suggests that artificial selection or directed evolution approaches may be needed to generate functionally diverse variants for experimental studies

What are the common challenges in working with recombinant Taar3 and how can they be addressed?

Working with recombinant Taar3 presents several technical challenges inherent to membrane proteins, particularly GPCRs:

  • Protein Solubility and Stability Issues:

    • Challenge: Membrane proteins often aggregate during purification

    • Solution: Use appropriate detergents for solubilization (e.g., DDM, LMNG); add stabilizing agents like glycerol (5-50%); store in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Low Functional Expression:

    • Challenge: Mouse Taar3 shows marginal activity in functional assays

    • Solution: Optimize expression systems; consider chimeric constructs with well-expressed GPCRs for N-terminal fusion; validate surface expression using immunofluorescence or ELISA

  • Ligand Identification Difficulties:

    • Challenge: Evidence suggests currently identified agonistic volatile amines may not be natural ligands

    • Solution: Employ broader screening approaches; test structurally diverse compound libraries; consider species-specific differences in ligand recognition

  • Storage and Stability:

    • Challenge: Protein degradation during storage

    • Solution: Lyophilization preserves long-term stability; avoid repeated freeze-thaw cycles; store working aliquots at 4°C for up to one week; for long-term storage, keep at -20°C/-80°C with glycerol as cryoprotectant

  • Functional Assay Sensitivity:

    • Challenge: Low signal-to-noise ratio in functional assays

    • Solution: Use amplification systems (e.g., enzyme-coupled assays); optimize cell density and expression time; consider more sensitive detection methods

How can researchers validate that their recombinant mouse Taar3 maintains native structural and functional properties?

Validating the native structural and functional properties of recombinant mouse Taar3 requires a multi-faceted approach:

  • Structural Validation:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Limited proteolysis to assess proper folding

    • Size-exclusion chromatography to verify monodispersity

    • Thermal stability assays to evaluate protein stability

  • Functional Validation:

    • cAMP accumulation assays, though mouse Taar3 has shown marginal activity

    • CRE-SEAP reporter gene assays with appropriate controls

    • Binding assays with putative ligands (though natural ligands may still be unknown)

    • Comparison with endogenously expressed receptor when possible

  • Surface Expression Verification:

    • Surface immunolabeling with antibodies against N-terminal tags

    • Flow cytometry to quantify expression levels

    • Immunofluorescence microscopy to visualize cellular localization

  • Comparative Analysis:

    • Side-by-side comparison with well-characterized GPCRs as benchmarks

    • Assessment of species-specific differences to contextualize functional data

    • Consideration of evolutionary constraints identified in statistical analyses

  • Negative Controls:

    • Testing with known non-ligands to confirm specificity

    • Utilizing receptor mutants with disrupted signaling capacity

    • Employing cells lacking endogenous G proteins or signaling components

Given the evidence of marginal activity of mouse Taar3 in reporter gene assays and cAMP accumulation assays , researchers should be prepared for potentially subtle functional readouts and consider employing multiple complementary assays to build a convincing case for structural and functional integrity.

How does correlated evolution between Taar3 and Taar4 inform multi-receptor research strategies?

The discovery of correlated evolution between TAAR3 and TAAR4 provides important direction for integrated research approaches:

  • Evidence for Functional Relationship:

    • Statistical analysis reveals significant overlap in pseudogenization events between TAAR3 and TAAR4 (Fisher's exact test, P = 0.01)

    • Evolutionary rates (dN/dS ratios) show significant correlation between TAAR3 and TAAR4 (Spearman's rank rs = 0.4870, P = 0.0252)

    • This suggests similar selective pressures and potentially related functions

  • Implications for Research Design:

    • Co-expression Studies: Design experiments that examine Taar3 and Taar4 co-expression patterns in tissues

    • Ligand Cross-reactivity: Test ligand panels against both receptors simultaneously

    • Signaling Integration: Investigate potential cooperative or competitive signaling interactions

    • Combinatorial Genetic Models: Consider double knockout/knockdown approaches to address functional redundancy

  • Comparative Pharmacology Strategy:

    • Create parallel pharmacological profiles of both receptors

    • Identify shared and distinct ligand recognition patterns

    • Develop ligands with controlled selectivity profiles between the receptors

  • Evolutionary Context Application:

    • Use species that maintain functional copies of both receptors versus those with pseudogenization of one or both

    • This natural experiment can provide insights into compensatory mechanisms

This correlated evolutionary pattern suggests that isolated studies of Taar3 alone may miss important biological context, and that integrative approaches examining both receptors may yield more physiologically relevant insights.

What experimental approaches can resolve the discrepancy between identified volatile amine agonists and potential natural ligands for Taar3?

Resolving the discrepancy between currently identified volatile amine agonists and the potential natural ligands for Taar3 requires innovative experimental strategies:

  • Comprehensive Screening Approaches:

    • Unbiased Metabolomics: Screen tissue extracts using LC-MS/MS to identify endogenous compounds that activate Taar3

    • Chemoinformatic Expansion: Use structural similarities to known partial agonists to predict and test novel candidate ligands

    • Species-Comparative Screening: Test ligand libraries against Taar3 from species with varying functional constraints

  • In Vivo Functional Approaches:

    • Taar3 Reporter Mice: Generate knock-in mice with reporter genes linked to Taar3 activation

    • In Vivo Imaging: Use calcium imaging in Taar3-expressing tissues to identify activating stimuli

    • Behavioral Assays: Compare wild-type and Taar3-deficient mice in response to chemical stimuli

  • Molecular Evolution-Guided Strategies:

    • Ancestral Reconstruction: Resurrect ancestral Taar3 sequences and test their ligand preferences

    • Molecular Dynamics: Simulate ligand binding to identify key interaction residues

    • Positive Selection Analysis: Focus on species lineages where Taar4 shows evidence of positive selection to inform Taar3 studies

  • Physiological Context Exploration:

    • Tissue-Specific Metabolite Profiling: Identify compounds present in tissues where Taar3 is expressed

    • Conditional Expression Systems: Control Taar3 expression in specific tissues to correlate with functional readouts

    • Microenvironment Recreation: Test receptor function under various physiological conditions (pH, ion concentrations)

The evidence that mouse and rat Taar3 show marginal activity in reporter gene assays while cow and primate Taar3 are non-functional suggests that natural ligands may differ significantly from currently tested compounds or that the receptor's primary function may not be as straightforward as direct ligand activation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.