Recombinant Mouse Trace amine-associated receptor 5 (Taar5)

Shipped with Ice Packs
In Stock

Description

Expression and Localization

TAAR5 is expressed in:

  • Olfactory System: Olfactory epithelium and glomerular layer of the olfactory bulb .

  • Limbic Brain: Anterior olfactory nucleus, amygdala, hippocampus, orbitofrontal cortex, and hypothalamic/thalamic nuclei .

In recombinant systems (e.g., HEK293 cells or Xenopus laevis oocytes), TAAR5 retains functional activity, enabling ligand-screening assays .

Agonists

LigandActivitySpeciesSource
TrimethylamineFull agonist (EC₅₀: ~100 nM)Mouse
N,N-DimethylethylaminePartial agonistHuman

Antagonists

CompoundActivityPotencySource
Timberol®96% inhibition of TMA-induced signalingHigh
Compound 1cAMP inhibition (IC₅₀: 1.2 µM)Submicromolar
Compound 2cAMP inhibition (IC₅₀: 2.8 µM)Submicromolar
3-IodothyronamineInverse agonistModerate

Note: Virtual screening (AtomNet®) and structure-based approaches identified seven novel antagonists, including compounds with low micromolar activity .

Behavioral and Physiological Roles

TAAR5-KO mice exhibit:

  • Reduced Anxiety/Depression: Lower performance in forced swim and elevated plus maze tests .

  • Serotonin Modulation: Decreased 5-HT and 5-HIAA levels in limbic regions, enhanced sensitivity to 5-HT1A agonists (e.g., 8-OH-DPAT) .

  • Odor Detection: Altered behavioral thresholds for TMA, indicating TAAR5’s role in setting sensitivity limits .

Research Applications and Therapeutic Potential

TAAR5 antagonists are prioritized for treating:

Therapeutic TargetMechanismEvidence
Anxiety/DepressionBlock TMA-induced limbic signalingTAAR5-KO mice show reduced stress responses
NeurodegenerationModulate serotonin and cAMP pathwaysAntagonists inhibit CREB/ERK phosphorylation

Recombinant TAAR5 systems enable high-throughput screening for small-molecule antagonists . Structural insights from homology models (e.g., β1-adrenoceptor) guide ligand design despite lacking experimental structures .

Comparative Analysis with Other TAARs

FeatureTAAR5TAAR7f (Murine)5-HT4R
Binding Pocket SizeSmall, occludedSimilar to TAAR5Larger
Key InteractionsAsp127³·³², Trp286⁶·⁴⁸Asp127³·³², Trp286⁶·⁴⁸Asp130³·³²
Ligand SpecificityTMA > Other aminesN-methylpiperidine5-HT

Data highlights conserved residues (Asp³·³², Trp⁶·⁴⁸) across TAARs but distinct ligand preferences .

Table 1: TAAR5 Antagonist Activity

CompoundActivityIC₅₀/EC₅₀Target PathwaySource
Timberol®TMA response inhibitionNA (96% inhibition)cAMP signaling
Compound 1cAMP inhibition1.2 µMCREB/ERK phosphorylation
Compound 2cAMP inhibition2.8 µMCREB/ERK phosphorylation

Table 2: TAAR5 Expression in Recombinant Systems

SystemReadoutApplicationSource
HEK293 cellscAMP assayAntagonist screening
Xenopus laevis oocytesElectrophysiological recordingLigand-binding kinetics

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method or location. For specific delivery time information, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage condition, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Taar5; Gm227; Trace amine-associated receptor 5; TaR-5; Trace amine receptor 5; mTaar5; Trimethylamine receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVS YFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLT SIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALS QWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSL AGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSAC NPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD
Uniprot No.

Target Background

Function
Trace amine-associated receptor 5 (TAAR5) is an olfactory receptor specific for trimethylamine. Trimethylamine is a trace amine found in elevated concentrations in the urine of male mice, playing a role in social behavior. It acts as an attractant, particularly after male mice reach puberty. TAAR5 is likely mediated by the G(s)-class of G-proteins, which activate adenylate cyclase.
Gene References Into Functions
  1. In mice, TAAR5 is encoded by adjacent genes and localizes to adjacent glomeruli, yet mediates opposing behaviors. PMID: 25616211
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in neurons of the olfactory epithelium, to discrete glomeruli predominantly localized to a confined bulb region. Present in the dorsal area of the main olfactory epithelium.

Q&A

What is TAAR5 and what is its biological significance?

TAAR5 (Trace Amine-Associated Receptor 5) belongs to a family of G-protein-coupled receptors in mammals that function as a second class of chemosensory receptors in the olfactory epithelium . Beyond olfaction, TAAR5 is expressed in various brain regions including the anterior olfactory nucleus, olfactory tubercle, orbitofrontal cortex, amygdala, hippocampus, piriform cortex, entorhinal cortex, nucleus accumbens, and thalamic and hypothalamic nuclei . The receptor plays a role in both chemosensory detection and potentially in modulating emotional behavior and serotonergic neurotransmission .

How does mouse TAAR5 compare structurally and functionally to human TAAR5?

Mouse TAAR5 shares considerable homology with human TAAR5 but demonstrates important functional differences. The most significant distinction is in ligand sensitivity: murine TAAR5 exhibits approximately 123-fold greater sensitivity to trimethylamine (TMA) compared to human TAAR5, with EC50 values of 940 nM and 116 μM respectively when measured under identical Cre-luciferase assay conditions . Additionally, mouse TAAR5 responds to a broader range of amines, including N-methylpiperidine and the secondary amine dimethylamine, while human TAAR5 is exclusively activated by tertiary amines with methyl or ethyl side chains .

What are the primary ligands for mouse TAAR5?

Mouse TAAR5 exhibits selective activation by specific amines:

LigandClassificationActivation StatusNotes
Trimethylamine (TMA)Tertiary amineFull agonistPresent in mouse urine, attractive to mice
Dimethylethylamine (DMEA)Tertiary aminePartial agonistLess potent than TMA
N-methylpiperidineCyclic amineAgonistActivates mouse but not human TAAR5
DimethylamineSecondary amineAgonistActivates mouse but not human TAAR5

Response measurements typically use forskolin (10 μM) as a reference standard for normalization .

What expression systems are optimal for recombinant mouse TAAR5 production?

Several expression systems have proven effective for mouse TAAR5:

  • Mammalian cell systems: HEK-293 cells provide a native-like membrane environment and appropriate post-translational modifications .

  • Xenopus laevis oocytes: This system has been successfully employed for electrophysiological characterization of TAAR5 activation using CFTR as a reporter channel .

  • Cell-free protein synthesis (CFPS): Can be used for rapid production of TAAR5 with purification tags like Strep Tag, achieving 70-80% purity as determined by SDS PAGE, Western Blot and analytical SEC .

The choice of expression system should be determined by the specific research application, with mammalian cells generally preferred for functional studies.

How can surface expression of mouse TAAR5 be optimized in recombinant systems?

To enhance functional surface expression of mouse TAAR5, co-expression with accessory proteins is critical. Receptor-transporting proteins (RTPs), particularly RTP1S, significantly improve membrane trafficking and surface localization of TAAR5 . Additionally, co-transfection with Gαolf enhances coupling efficiency to downstream signaling pathways, thereby increasing assay sensitivity . Researchers should consider these factors when designing expression constructs for functional studies, as sub-optimal surface expression can substantially reduce measured receptor activity and lead to false negatives during ligand screening.

What assay systems are recommended for measuring mouse TAAR5 activation?

Multiple complementary approaches can be employed to characterize TAAR5 activity:

Assay SystemMeasurementAdvantagesConsiderations
CRE-luciferaseLuminescence from cAMP-responsive elementsHigh-throughput capability, quantitativeRequires co-transfection of reporter constructs
Xenopus oocyte electrophysiologyCurrents via CFTR reporter channelDirect measurement of activation kineticsLower throughput, more technically demanding
CRE-SEAPSecreted alkaline phosphatase activitySuitable for longer time-course studiesPotentially lower sensitivity than luciferase-based methods

When using the Xenopus oocyte system, 3-isobutyl-1-methylxanthine (IBMX) serves as an appropriate positive control, with TMA (100 μM) and DMEA (100 μM) producing responses at 42.5±12.8% and 14.6±6.0% of IBMX-induced currents, respectively .

How should researchers address sensitivity differences between recombinant systems and in vivo function?

A significant challenge in TAAR5 research is reconciling the discrepancy between receptor sensitivity in recombinant systems and observed in vivo olfactory thresholds. The olfactory detection threshold for TMA in water is approximately 8 nM, considerably lower than the activation thresholds observed in recombinant systems (even for the more sensitive mouse TAAR5) .

To address this challenge:

  • Always include both positive controls and mock-transfected controls to establish assay dynamic range .

  • Consider testing multiple expression conditions by varying the ratios of receptor, accessory proteins, and G-proteins to optimize functional coupling .

  • When comparing between studies, acknowledge that different assay systems (e.g., Cre-SEAP vs. Cre-luciferase) may yield different apparent EC50 values due to variations in sensitivity and signal amplification .

  • Validate key findings using multiple independent assay systems, as demonstrated by studies confirming TAAR5 activation with both Cre-luciferase and Xenopus oocyte electrophysiology approaches .

How are TAAR5 knockout mice generated and validated?

TAAR5 knockout (TAAR5-KO) mice have been generated through targeted gene replacement strategies. The methodology involves:

  • Construction of a replacement vector containing a LacZ-coding sequence fused to a nuclear localization sequence (NLS), a PgK-NeoR, and a diphtheria toxin cassette .

  • Targeting the region from positions 1 to 320 of the mouse Taar5 gene (NCBI Gene ID: 215854) .

  • Linearization of the targeting vector with SacII and electroporation into C57BL/6 embryonic stem (ES) cells .

  • Selection of G-418 resistant ES cell clones and identification of homologous recombination events by PCR .

  • Generation of chimeras according to standard protocols and maintenance of the recombinant allele in C57BL/6 background in specific pathogen-free facilities .

This approach not only knocks out TAAR5 function but also introduces a β-galactosidase reporter that enables comprehensive mapping of TAAR5 expression patterns in the brain and periphery.

What neurochemical and behavioral phenotypes are observed in TAAR5-KO mice?

TAAR5-KO mice exhibit several distinct phenotypes that provide insight into the receptor's physiological functions:

  • Neurochemical changes: Significant decreases in tissue levels of serotonin and its metabolite in several brain areas, suggesting TAAR5 modulates serotonergic neurotransmission .

  • Altered pharmacological responses: Enhanced sensitivity to the hypothermic effects of 5-HT1A receptor agonist 8-hydroxy-2-(di-n-propylamino)tetralin (8-OH-DPAT) .

  • Behavioral phenotypes: Reduced anxiety- and depressive-like behaviors across multiple behavioral tests without gross developmental abnormalities .

These findings suggest TAAR5 may play an important role beyond olfaction, potentially influencing emotional behavior through modulation of serotonergic systems.

How can recombinant mouse TAAR5 be used for high-throughput ligand discovery?

Recombinant mouse TAAR5 provides an excellent platform for systematic ligand screening. An effective approach involves:

  • Stable expression of TAAR5 in HANA3A cells (or similar mammalian expression systems) with appropriate accessory proteins .

  • Implementation of a Cre-luciferase reporter system for rapid quantification of receptor activation .

  • Systematic screening of compound libraries, focusing on amine and amine-like substances at standardized concentrations (typically 100 μM for initial screens) .

  • Normalization of responses to a reference compound (forskolin at 10 μM is commonly used) to facilitate comparison between experimental runs .

  • Secondary validation of hit compounds using concentration-response curves to determine EC50 values .

This approach has been successfully employed to screen 42 different amines and determine specific activators of TAAR5 .

What strategies can researchers use to investigate TAAR5's dual role in olfaction and central nervous system function?

The emerging evidence for TAAR5 expression beyond the olfactory system necessitates multifaceted research approaches:

  • Expression mapping: Leverage TAAR5-KO mice expressing β-galactosidase to comprehensively map receptor expression throughout the brain, with particular focus on limbic regions implicated in emotional processing .

  • Circuit dissection: Trace neural projections from TAAR5-expressing neurons in the olfactory bulb to downstream limbic structures to understand how olfactory TAAR5 activation might influence central nervous system function .

  • Behavioral pharmacology: Administer TAAR5 ligands (e.g., TMA) while monitoring both olfactory responses and changes in emotional behaviors to distinguish direct central effects from olfactory-mediated effects .

  • Conditional knockout approaches: Develop region-specific TAAR5 knockout models to selectively eliminate TAAR5 function in the olfactory epithelium versus specific brain regions.

  • Comparative genetics: Compare TAAR5 polymorphisms between individuals with specific anosmias for TMA to identify potential structure-function relationships, although preliminary studies have not found significant associations between TMA anosmia and TAAR5 coding variants .

How does understanding species differences in TAAR5 inform translational research?

The documented differences between mouse and human TAAR5 have important implications for translational research:

  • Mouse TAAR5 exhibits broader ligand specificity, responding to secondary amines and N-methylpiperidine that do not activate human TAAR5 .

  • Mouse TAAR5 demonstrates significantly higher sensitivity to TMA (EC50 of 940 nM vs. 116 μM for human TAAR5) .

  • TMA elicits attractive behaviors in mice but aversive responses in humans, suggesting potential species-specific signaling outcomes downstream of TAAR5 activation .

These differences highlight the need for caution when extrapolating findings from mouse models to human applications. Researchers should consider validating key findings in both species whenever possible and recognize that TAAR5-targeted therapeutics may require species-specific optimization of pharmacological properties.

What purification strategies yield the highest quality recombinant mouse TAAR5?

For optimal purification of recombinant mouse TAAR5:

  • Expression with appropriate affinity tags (His tag or Strep tag) facilitates efficient purification while maintaining protein functionality .

  • Quality assessment should include multiple complementary methods: Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC (HPLC) .

  • Recombinant TAAR5 expressed in HEK-293 cells can achieve >90% purity when appropriate purification strategies are employed .

  • Storage recommendations include maintaining purified protein at -80°C and avoiding repeated freeze-thaw cycles to preserve functional integrity .

Careful attention to these technical details ensures that functional studies are conducted with high-quality receptor preparations, reducing experimental variability and enhancing reproducibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.