Recombinant Mouse Trace amine-associated receptor 7b (Taar7b)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Taar7b

Recombinant Taar7b is a full-length transmembrane protein (1–358 amino acids) produced in E. coli via bacterial expression systems. It is His-tagged at the N-terminus to facilitate purification and structural studies . Key features include:

ParameterSpecificationSource
SpeciesMus musculus (Mouse)
Expression SystemE. coli
TagN-terminal 10xHis-tag
Protein LengthFull-length (1–358 residues)
Purity>90% (SDS-PAGE validated)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)

This recombinant protein is lyophilized and stabilized with glycerol (50% final concentration) for long-term storage at -20°C/-80°C .

Functional Role

TAARs are implicated in chemosensory detection of trace amines (e.g., p-tyramine, β-phenylethylamine), though Taar7b’s specificity remains under investigation. In related receptors, ligand binding induces conformational changes that disrupt the ionic lock (Arg3.50-Asp3.49) and activate G protein signaling .

Research Applications

Recombinant Taar7b serves as a tool for:

  1. Structural Studies:

    • Cryo-EM or X-ray crystallography to resolve receptor conformations .

  2. Ligand Screening:

    • High-throughput assays to identify novel agonists/antagonists .

  3. Signaling Pathway Analysis:

    • Mutagenesis studies to map residues critical for G protein coupling (e.g., Asp127, Trp286) .

Comparative Analysis with Related Receptors

A comparison of Taar7b with other TAARs and aminergic receptors reveals shared and divergent features:

FeatureTaar7bmTAAR7fβ2-Adrenergic Receptor
Binding Pocket SizeSmall (similar to mTAAR7f)Small, occluded architectureLarger, extracellular access
Key ResiduesAsp127, Trp286, Tyr316 (inferred)Asp127, Trp286, Tyr316Asp113, Trp158, Tyr316
G Protein CouplingLikely cAMP/PKA pathwaycAMP/PKA pathwaycAMP/PKA pathway
Ligand SpecificityUncharacterizedAmines (e.g., DMCHA)Catecholamines (e.g., epinephrine)

Handling and Stability

Proper handling ensures optimal performance:

  • Storage:

    • Lyophilized: -20°C/-80°C; avoid repeated freeze-thaw cycles .

    • Reconstituted: 4°C for ≤1 week; add 5–50% glycerol for long-term storage .

  • Reconstitution:

    • Use deionized sterile water to a concentration of 0.1–1.0 mg/mL .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Taar7b; Gm698; Trace amine-associated receptor 7b; TaR-7b; Trace amine receptor 7b; mTaar7b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Taar7b
Target Protein Sequence
MATDNDSFPWDQDSILSSDMFSATSTELCYENLNRSCVRSPYSPGPRLILYAVFGFGAAL AVCGNLLVMTSILHFRQLHSPANFLVVSLACADFLVGLTVMPFSTVRSVEGCWYFGESYC KLHTCFDVSFCYCSIFHLCFISVDRYIAVSDPLTYPTRFTAFVSGKCITFSWLLSTIYGF SLLYTGANEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLIPTLVMITVYSKIFLIAK QQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLIVSGKVLRENSSTTNLFPE
Uniprot No.

Target Background

Function
Orphan olfactory receptor specific for trace amines.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in neurons of the olfactory epithelium.

Q&A

How does mouse Taar7b relate to other trace amine-associated receptors?

Mouse Taar7b is one of several TAAR family members that have evolved to detect trace amines. While TAAR1 has been extensively studied and shown to respond to substrates like tyramine, octopamine, and β-phenylethylamine , the specific ligand profile of Taar7b is less thoroughly characterized.

The TAAR family has been cataloged across multiple species through genomic sequence analysis, revealing their chromosomal localization, orientation, and intron presence/absence . Mouse Taar7b shares the conserved transmembrane motif that defines this receptor family but may have distinct ligand preferences compared to other TAARs like TAAR1, which has been implicated in conditions including obesity, schizophrenia, depression, and addiction .

What expression systems are suitable for producing recombinant mouse Taar7b?

Recombinant mouse Taar7b can be successfully expressed in prokaryotic systems, particularly E. coli, as demonstrated by commercial preparations . For research requiring functional receptor, the following methodological considerations are important:

  • Expression system selection:

    • E. coli: Suitable for producing protein for structural studies or antibody generation

    • Mammalian cells (HEK293, CHO): Preferred for functional studies requiring proper folding and post-translational modifications

    • Insect cells (Sf9, Sf21): Useful for higher yields of properly folded GPCRs

  • Purification approach:

    • Affinity tags (His-tag, as used in commercial preparations) facilitate purification

    • Detergent selection is critical for maintaining membrane protein structure

  • Storage conditions:

    • Lyophilized powder form enhances stability

    • Reconstitution in Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Addition of 5-50% glycerol for long-term storage at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

What are the challenges in developing selective ligands for mouse Taar7b?

Developing selective ligands for mouse Taar7b presents several research challenges that require methodological solutions:

ChallengeMethodological Approach
Structural similarity to other TAARsUtilize bioinformatic analysis of binding pocket differences between TAAR subtypes
Lack of crystal structureEmploy homology modeling based on related GPCRs with resolved structures
Cross-reactivity with other amine receptorsDesign screening cascades with counter-screens against related receptors
Species differences in ligand bindingPerform comparative pharmacology between mouse and human TAAR orthologues

Pharmacological investigations have shown that many TAAR subtypes may not respond to classic trace amines like p-tyramine, β-phenylethylamine, tryptamine, or octopamine , suggesting that Taar7b might have unique, yet-to-be-identified endogenous ligands. Addressing these challenges requires multidisciplinary approaches combining computational prediction, medicinal chemistry, and functional screening assays.

How can genetic polymorphisms affect mouse Taar7b function in experimental studies?

Genetic polymorphisms can significantly impact Taar7b function, similar to what has been observed with TAAR1 . When designing experiments, researchers should consider:

  • Mouse strain selection: Different laboratory mouse strains may harbor Taar7b polymorphisms that affect receptor function, expression levels, or signaling capacity.

  • Sequencing verification: It is advisable to sequence the Taar7b gene from your experimental animals to identify any variations from the reference sequence.

  • Functional consequences: Polymorphisms may affect:

    • Ligand binding affinity

    • G-protein coupling efficiency

    • Receptor expression levels

    • Subcellular localization

  • Experimental controls: Include appropriate genetic controls when using genetically modified mice to ensure observed phenotypes are specifically due to Taar7b manipulation.

Research on TAAR1 has demonstrated that genetic polymorphisms can affect receptor function in both mice and humans , suggesting similar considerations would be relevant for Taar7b studies.

What are the optimal approaches for studying Taar7b signaling pathways?

When investigating Taar7b signaling pathways, consider these methodological approaches:

  • Receptor activation measurement:

    • cAMP assays (if Gαs-coupled)

    • Ca²⁺ mobilization assays (if Gαq-coupled)

    • MAPK phosphorylation

    • β-arrestin recruitment

  • Expression systems for signaling studies:

    • Heterologous systems (HEK293, CHO cells)

    • Primary neurons or glial cells

    • Brain slice preparations

  • Signaling pathway delineation:

    • Use specific G-protein inhibitors (e.g., pertussis toxin for Gαi)

    • Apply pathway-specific inhibitors (e.g., PKA, PKC inhibitors)

    • Employ CRISPR/Cas9 to knock out pathway components

  • Real-time signaling analysis:

    • FRET-based sensors for cAMP or Ca²⁺

    • Bioluminescence resonance energy transfer (BRET)

    • Electrophysiological recordings in neuronal preparations

Based on research with related receptors like TAAR1, which alters glutamatergic function and affects dopamine availability in the brain , Taar7b might have important neuromodulatory functions that require careful experimental design to elucidate.

How should researchers design experiments to study potential physiological roles of Taar7b?

To investigate the physiological roles of Taar7b, consider these experimental approaches:

  • In vitro studies:

    • Receptor expression mapping using RT-PCR, in situ hybridization, or immunohistochemistry

    • Ligand identification through screening of endogenous amines and metabolites

    • Signal transduction pathway characterization

  • Ex vivo approaches:

    • Brain slice electrophysiology to assess effects on neuronal activity

    • Tissue-specific responses to potential Taar7b ligands

  • In vivo models:

    • Generation of Taar7b knockout or conditional knockout mice

    • Behavioral testing related to potential functions (olfaction, feeding, etc.)

    • Overexpression models using viral vectors

  • Disease model relevance:

    • Assessment of Taar7b involvement in neuropsychiatric conditions

    • Investigation of potential inflammatory roles, as TAARs are expressed on lymphocytes

    • Evaluation of cardiovascular effects, given TAAR expression in heart tissue

When designing these experiments, it is essential to include appropriate controls and confirm the specificity of any observed effects through multiple approaches.

What are the recommended protocols for recombinant Taar7b protein reconstitution and handling?

For optimal handling of recombinant mouse Taar7b protein:

  • Reconstitution procedure:

    • Briefly centrifuge the vial before opening to collect all material

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is commonly used) for storage

    • Aliquot to avoid repeated freeze-thaw cycles

  • Storage recommendations:

    • Store at -20°C/-80°C upon receipt

    • Working aliquots can be maintained at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which can compromise protein integrity

  • Quality control assessments:

    • Verify purity using SDS-PAGE (should exceed 90%)

    • Confirm protein identity via Western blot or mass spectrometry

    • If functional studies are planned, validate activity using appropriate assays

  • Functional reconstitution (for activity studies):

    • Consider incorporation into liposomes or nanodiscs for maintaining native conformation

    • Use detergents compatible with GPCR stability (e.g., DDM, LMNG)

    • Include cholesterol in reconstitution mixtures to enhance stability

What methodologies are effective for detecting expression and localization of Taar7b in mouse tissues?

To investigate Taar7b expression and localization in mouse tissues:

  • Transcript detection:

    • RT-PCR with Taar7b-specific primers

    • RNAscope in situ hybridization for high-sensitivity detection

    • Single-cell RNA sequencing for cell type-specific expression profiling

  • Protein detection:

    • Immunohistochemistry with validated anti-Taar7b antibodies

    • Western blotting of tissue lysates

    • Flow cytometry for expression on immune cells (if relevant)

  • Subcellular localization:

    • Confocal microscopy with fluorescent-tagged antibodies

    • Electron microscopy with immunogold labeling

    • Biochemical fractionation followed by Western blotting

  • Transgenic approaches:

    • Generation of Taar7b-GFP reporter mice for live visualization

    • Taar7b-Cre lines for cell-specific manipulations

When performing these studies, it is essential to include proper negative controls (e.g., Taar7b knockout tissue) to confirm antibody specificity, as GPCR antibodies often show cross-reactivity.

How can researchers address inconsistent results in Taar7b functional studies?

When facing inconsistent results in Taar7b studies, consider these methodological approaches:

  • Receptor expression variability:

    • Quantify receptor expression levels across experiments

    • Use tetracycline-inducible systems for controlled expression

    • Validate surface expression using flow cytometry or surface biotinylation

  • Experimental condition standardization:

    • Maintain consistent cell passage numbers

    • Standardize buffer compositions and temperatures

    • Control for serum lot variations in culture media

  • Genetic variation considerations:

    • Sequence Taar7b from your experimental material

    • Consider strain differences if working with different mouse lines

    • Be aware that genetic polymorphisms can affect TAAR function

  • Technical approaches to reduce variability:

    • Use internal standards in each experiment

    • Perform parallel positive controls with well-characterized receptors

    • Employ multiple complementary assays to confirm findings

  • Statistical analysis:

    • Use appropriate statistical tests for your experimental design

    • Consider power analysis to determine adequate sample sizes

    • Account for multiple comparisons when analyzing large datasets

What bioinformatic resources are most valuable for Taar7b research?

For comprehensive Taar7b bioinformatic analysis, utilize these resources and methodological approaches:

Resource TypeSpecific Tools and Methods
Sequence databasesUniProt (Q5QD11) , GenBank, Ensembl
Structural predictionAlphaFold, I-TASSER, SWISS-MODEL for homology modeling
Phylogenetic analysisMEGA, PhyML, MrBayes for evolutionary relationships with other TAARs
Comparative genomicsGenome browsers (UCSC, Ensembl) to examine conservation and synteny
Ligand predictionMolecular docking software (AutoDock, Glide), pharmacophore modeling
Expression dataGene Expression Omnibus (GEO), Mouse Brain Atlas, Single Cell Portal

When analyzing Taar7b using bioinformatic approaches:

  • Leverage the conserved TAAR motif (NSXXNPXX[YH]XXX[YF]XWF) to verify sequence authenticity

  • Compare with other TAAR family members to identify unique structural features

  • Use multiple alignment tools to identify conserved residues likely involved in ligand binding

  • Consider both the transmembrane domains and extracellular loops for ligand interaction sites

How does mouse Taar7b research translate to understanding human TAAR biology?

When considering the translational relevance of mouse Taar7b research:

  • Evolutionary conservation analysis:

    • Determine if Taar7b has a direct human orthologue or closest human homologue

    • Compare binding pocket conservation between species

    • Identify species-specific ligand preferences

  • Functional comparison strategies:

    • Express both mouse Taar7b and human TAAR counterparts in the same system

    • Compare pharmacological profiles using identical assay conditions

    • Identify conserved signaling pathways across species

  • Disease relevance considerations:

    • Research suggests TAAR family members may be implicated in conditions including obesity, schizophrenia, depression, fibromyalgia, migraine, and addiction

    • Investigate whether mouse Taar7b studies provide insights into these conditions

    • Consider immune and cardiovascular functions, as TAARs are expressed in lymphocytes and heart tissue

  • Genetic variation impact:

    • Study how genetic polymorphisms affect both mouse and human TAAR function

    • Determine if findings from mouse genetic studies have parallels in human genetics

What are emerging research directions for Taar7b beyond classical neurotransmitter systems?

Exciting new research directions for Taar7b include:

  • Immune system functions:

    • Investigation of Taar7b expression in mouse immune cells

    • Role in inflammation and response to infection (TAARs are expressed on lymphocytes)

    • Potential immunomodulatory effects of Taar7b ligands

  • Metabolic regulation:

    • TAAR1 has been implicated in obesity , suggesting Taar7b might have metabolic functions

    • Potential role in detecting diet-derived trace amines

    • Effects on energy homeostasis and feeding behavior

  • Microbiome interaction:

    • Exploration of microbially-produced trace amines as Taar7b ligands

    • Role in host-microbiome communication

    • Impact of gut microbiota alterations on Taar7b-mediated signaling

  • Cardiovascular physiology:

    • TAARs are expressed at low levels in heart tissue and may regulate cardiovascular tone

    • Potential role of Taar7b in cardiac function

    • Interaction with autonomic regulation of cardiovascular parameters

These emerging directions expand the traditional view of trace amine receptors beyond their neurological functions and highlight the importance of comprehensive physiological studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.