Recombinant Mouse Trace amine-associated receptor 7d (Taar7d)

Shipped with Ice Packs
In Stock

Description

Primary Structure and Sequence

Taar7d encodes a 358-amino-acid protein (UniProt: Q5QD10) with a molecular weight of approximately 40.3 kDa . Key features include:

  • Transmembrane domains: Seven predicted α-helical transmembrane (TM) domains, characteristic of GPCRs.

  • N-terminal and extracellular loops: Folded into a disulfide-bonded structure that contributes to ligand recognition .

  • C-terminal intracellular domain: Interacts with G proteins (e.g., Gαolf) for signal transduction .

Production and Purity

Taar7d is synthesized via recombinant methods, including:

Host SystemTagPuritySource
Cell-free expressionN/A≥85% (SDS-PAGE)
E. coli/YeastStrep/6-His70–80% (SEC/HPLC)
Baculovirus/MammalianPartial fragments≥85%

Predicted Partners and Pathways

Taar7d interacts with proteins critical to olfactory signaling and G protein-mediated pathways:

PartnerFunctionInteraction ScoreSource
GnalGαolf subunit; mediates cAMP signaling0.619
Gucy2dGuanylate cyclase D; linked to social behavior0.518
Vmn1r51Vomeronasal pheromone receptor0.664

Key Uses in Studies

ApplicationDetailsSource
ELISADetects Taar7d in lysates or purified samples
SDS-PAGE/Western BlotVerifies expression and purity
Functional StudiesInvestigates ligand binding (e.g., trace amines)

Species-Specific Considerations

  • Rodent vs. Human TAARs: Structural divergence in TM domains (e.g., Y7.39 in mouse vs. N7.39 in rat) influences ligand specificity .

  • Functional Implications: Mouse Taar7d may exhibit distinct binding profiles compared to human TAAR1, which is activated by β-phenethylamine and amphetamines .

Unresolved Questions

  1. Ligand Identification: No endogenous ligands confirmed for Taar7d.

  2. In Vivo Role: Limited data on physiological relevance in olfaction or social behavior.

  3. Activation Mechanism: Differences in TM5/TM6 dynamics compared to β2AR require further study .

Potential Research Avenues

  • High-Throughput Screening: Identify synthetic or endogenous ligands.

  • Cryo-EM Structural Studies: Elucidate Taar7d’s active-state conformation.

  • Behavioral Assays: Examine Taar7d knockout mice for olfactory or social deficits.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate your request in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Taar7d; Trace amine-associated receptor 7d; TaR-7d; Trace amine receptor 7d; mTaar7d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Taar7d
Target Protein Sequence
MATGDDSFPWDQDSILSRDLFSATSTELCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGVMVMPFSMVRSVEGCWYFGESYC KFHSCFEGSFCYSSLFHLCFISVDRYIAVSDPLTYPTRFTASVSGKCITFSWLLSIIYSF SLLYTGANDAGLEDLVSALTCVGGCQIAVNQTWVFINFLLFLIPTLVMITVYSKIFLIAK QQAQNIEKMSKQTARASESYKDRVTKRERKAAKTLGIAVAAFLLSWLPYFIDSIIDAFLG FITPTYVYEILVWIVYYNSAMNPLIYAFFYSWFRKAIKLIVSGKILRENSSTTNLFPE
Uniprot No.

Target Background

Function
Orphan olfactory receptor specific for trace amines.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in neurons of the olfactory epithelium.

Q&A

What is Recombinant Mouse Trace amine-associated receptor 7d?

Recombinant Mouse Trace amine-associated receptor 7d (Taar7d) is a G Protein-Coupled Receptor (GPCR) encoded by the Taar7d gene (also known as taR-7d) that functions as an olfactory receptor in the vertebrate sensory system . As part of the trace amine-associated receptor family, Taar7d plays a role in olfaction, particularly in detecting specific volatile amines. The recombinant form of this protein is produced through molecular cloning and expression techniques to facilitate research applications, enabling structural and functional studies that would be difficult with naturally occurring quantities . Recombinant Taar7d is typically expressed with greater than 85% purity as determined by SDS-PAGE and can be produced in multiple expression systems including cell-free expression, E. coli, yeast, baculovirus, and mammalian cell systems .

How does Taar7d relate to other members of the TAAR family?

Taar7d belongs to the rapidly evolving TAAR7 subfamily within the larger TAAR family . Unlike some conserved TAARs that show consistent ligand recognition across species, the TAAR7 lineage demonstrates significant evolutionary changes through gene duplication and subsequent mutation that have altered ligand recognition properties . In the mouse genome, TAAR7d exists alongside related subfamily members, with the entire TAAR7 group showing evidence of functional expansion of the olfactory receptor repertoire . While some TAARs like TAAR4 and TAAR5 are encoded by adjacent genes and localize to adjacent glomeruli in the olfactory bulb despite mediating opposing behaviors, the specific neural circuitry of Taar7d expression requires further investigation . The evolutionary plasticity of the TAAR7 subfamily makes it particularly interesting for studying receptor evolution and specialization.

What are the key structural features of Taar7d relevant to experimental design?

Taar7d, like other TAARs, contains the canonical seven transmembrane α-helical fold characteristic of rhodopsin-like GPCRs . Structural modeling based on crystallographic data from related receptors (such as β-adrenergic receptors) provides insight into the putative ligand-binding domain . A key structural feature is the presence of Asp3.32 (using Ballesteros-Weinstein indexing), which is conserved in most mouse TAARs (13/15) and forms a critical salt bridge for ligand binding . The ligand binding occurs in the membrane plane, with contacts distributed across transmembrane α-helices . Based on studies of related TAAR7 subfamily members (TAAR7e and TAAR7f), specific residues in transmembrane 3 (positions 3.37 and 3.38) are likely critical determinants of ligand selectivity in Taar7d as well . Understanding these structural features is essential for designing experiments involving ligand binding, mutagenesis studies, or structural analysis.

What expression systems are optimal for Recombinant Mouse Taar7d production?

Multiple expression systems can be used for Recombinant Mouse Taar7d production, each with particular advantages depending on research objectives. Available systems include cell-free expression, E. coli, yeast, baculovirus, and mammalian cell systems . For initial expression optimization, a prokaryotic system like E. coli BL21(DE3) can be effective, as demonstrated in similar recombinant protein studies . For optimal expression in bacterial systems, Terrific Broth (TB) culture medium with induction using 0.25 mM IPTG at 15°C for 24 hours has been shown to yield good results for mouse recombinant proteins . Cell-free expression systems offer advantages for membrane proteins like Taar7d by eliminating cell membrane insertion challenges, potentially providing higher yields of properly folded protein . For studies requiring post-translational modifications or mammalian-like protein folding, mammalian or insect cell expression systems may be preferable despite their higher cost and complexity .

How can I optimize purification of Recombinant Mouse Taar7d?

Purification of Recombinant Mouse Taar7d requires careful optimization to maintain protein structure and function. Based on similar membrane protein purification protocols, buffers containing mild detergents like 2% sarkosyl can produce higher yield and purity for recombinant mouse proteins . For Taar7d specifically, purification typically begins with cell lysis under conditions that solubilize membrane-associated proteins, followed by affinity chromatography if the recombinant construct includes an affinity tag . The purification process should aim to achieve at least 85% purity as determined by SDS-PAGE . Critical factors to optimize include: (1) detergent type and concentration for solubilization, (2) buffer pH and ionic strength, (3) presence of stabilizing agents like glycerol or specific ligands, and (4) temperature conditions during purification. When designing purification protocols, researchers should consider that membrane proteins often require special handling to maintain native conformation and activity.

What experimental design parameters most significantly affect Taar7d expression yield?

Several experimental design parameters critically influence Taar7d expression yield and quality. Based on recombinant protein expression studies, the following table summarizes key parameters and their optimization:

ParameterOptimal ConditionImpact on Expression
Bacterial strainBL21(DE3)Provides controlled expression with T7 RNA polymerase system
Culture mediumTerrific Broth (TB)Richer medium supports higher cell density and protein yield
Induction temperature15°CLower temperatures reduce inclusion body formation and increase soluble protein
IPTG concentration0.25 mMModerate inducer concentration balances expression rate with proper folding
Induction time24 hoursExtended time at lower temperature allows accumulation of properly folded protein
Detergent for extraction2% sarkosylEffectively solubilizes membrane proteins while maintaining structure

When designing expression experiments, systematic variation of these parameters following design of experiments (DOE) methodology is recommended to identify optimal conditions for your specific Taar7d construct . This approach allows for efficient identification of main effects and interactions between variables, leading to optimized expression protocols with fewer experimental runs .

How can I verify the functional activity of recombinant Taar7d?

Verification of functional activity for recombinant Taar7d requires demonstration of specific ligand binding and downstream signaling activation. A comprehensive approach includes multiple complementary techniques:

  • Ligand binding assays: Direct binding assays using radioligand competition or fluorescent ligands can confirm receptor-ligand interaction. Based on TAAR family studies, amine compounds represent potential ligands, as Taar7d likely retains amine recognition capacity due to the conserved Asp3.32 residue .

  • Signaling assays: As a GPCR, Taar7d likely signals through G-protein dependent pathways. Functional coupling can be assessed using:

    • cAMP accumulation assays (if Gαs-coupled)

    • Calcium mobilization assays (if Gαq-coupled)

    • ERK phosphorylation or other downstream signaling events

  • Conformational analysis: Techniques such as circular dichroism or limited proteolysis can verify proper protein folding, which is prerequisite for function.

  • Cellular localization: For expression in mammalian cells, proper trafficking to the plasma membrane can be verified using confocal microscopy with fluorescently tagged constructs.

  • Comparative analysis: Testing the receptor against known ligands for related TAAR7 subfamily members can provide functional validation, as TAAR orthologs often recognize similar chemical structures despite varying sensitivities .

Verification should incorporate appropriate controls, including known non-functional receptor mutants or closely related receptors with distinct ligand profiles to confirm specificity of responses.

What are the most effective methods for studying Taar7d-ligand interactions?

Studying Taar7d-ligand interactions requires a combination of computational, biochemical, and cellular approaches. Based on structural studies of related TAARs, the following methodological approaches are recommended:

  • Computational modeling and docking: Generate structural models of Taar7d based on crystallographic data from related GPCRs like β-adrenergic receptors . In silico docking studies can predict binding poses and interaction energies for potential ligands. Molecular dynamics simulations can further refine understanding of binding pocket flexibility and ligand recognition.

  • Site-directed mutagenesis: Targeted mutation of predicted binding pocket residues, particularly those in transmembrane domains, can validate computational models. Focus on Asp3.32 (essential for amine recognition) and positions 3.37 and 3.38, which are critical selectivity determinants in related TAAR7 receptors .

  • Ligand structure-activity relationship (SAR) studies: Systematic testing of structurally related compounds can map the chemical requirements for receptor activation. For the TAAR7 subfamily, specificity is likely determined by interactions with transmembrane residues, particularly Van der Waals interactions with position 3.37 .

  • Biophysical binding assays: Surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) can provide direct measurement of binding affinities and thermodynamic parameters.

When designing these experiments, remember that ligand selectivity differences between closely related TAAR7 subfamily members are determined by subtle structural variations, particularly in transmembrane regions .

How should I design experiments to investigate Taar7d signaling pathways?

Designing experiments to investigate Taar7d signaling pathways requires careful consideration of multiple factors:

  • Experimental system selection: Choose between:

    • Heterologous expression systems (HEK293, CHO cells) for isolated pathway analysis

    • Native neuronal cells for physiological context

    • In vivo models for behavioral outcomes

  • Pathway component analysis: Design experiments to systematically investigate:

    • G-protein coupling specificity (Gαs, Gαi/o, Gαq/11)

    • Second messenger generation (cAMP, Ca²⁺, IP₃)

    • Downstream effector activation (protein kinases, transcription factors)

    • Receptor regulation (internalization, desensitization, recycling)

  • Temporal resolution: Include time-course experiments to distinguish between immediate, intermediate, and delayed signaling events.

  • Signal integration: As TAARs function as olfactory receptors, design experiments to investigate integration with other sensory inputs at the cellular and circuit levels.

  • Validation approaches:

    • Pharmacological inhibitors of specific pathway components

    • siRNA/shRNA knockdown of signaling proteins

    • CRISPR-Cas9 mediated genetic modification

    • Phosphoproteomic analysis to identify signaling networks

The experimental design should follow true experimental research design principles with appropriate controls, randomization, and variable manipulation to establish causality . Given that TAAR-expressing neurons engage higher-order neural circuits to encode odor valence, investigations beyond cellular signaling into neural circuit engagement will provide more comprehensive understanding .

How does the evolution of mouse Taar7d compare to other TAAR family members?

The evolutionary trajectory of mouse Taar7d showcases important differences when compared to other TAAR family members. The TAAR7 subfamily represents a case of rapid evolution and functional expansion through gene duplication and subsequent mutation . This evolutionary pattern contrasts with more conserved TAARs:

  • Evolutionary rate: The TAAR7 subfamily shows accelerated evolution compared to other TAARs, with recent mutations that have changed ligand recognition properties . This rapid evolution suggests adaptive responses to changing environmental detection needs.

  • Cross-species conservation: While many TAAR orthologs across species maintain similar ligand recognition profiles with varying sensitivities, the TAAR7 subfamily shows more divergence . This suggests species-specific adaptation rather than conserved function.

  • Functional diversification: The mouse TAAR7 lineage provides direct evidence for functional expansion of the olfactory receptor repertoire through gene duplication followed by mutation . This pattern allows for detection of an expanded range of odorants.

  • Structural determinants: Comparative analysis between TAAR7 subfamily members (e.g., TAAR7e vs. TAAR7f) reveals that ligand selectivity differences are determined by just two adjacent transmembrane 3 residues (positions 3.37 and 3.38) . This demonstrates how minimal sequence changes can drive functional divergence.

When designing evolutionary studies of Taar7d, researchers should employ comparative genomic approaches across species alongside functional characterization to connect sequence changes with altered receptor properties.

What techniques can resolve contradictory data in Taar7d signaling studies?

Resolving contradictory data in Taar7d signaling studies requires systematic application of complementary approaches:

  • Standardization of experimental conditions: Contradictions often arise from variations in:

    • Expression systems (mammalian vs. yeast vs. cell-free)

    • Receptor construct design (tags, fusion partners)

    • Assay conditions (temperature, pH, ionic strength)

    Design experiments that systematically vary these parameters to identify condition-dependent effects .

  • Multiple signaling readouts: Measure several downstream pathways simultaneously, as receptor coupling may be promiscuous or context-dependent:

    • G-protein subtype activation (BRET-based sensors)

    • Second messenger generation (cAMP, Ca²⁺)

    • β-arrestin recruitment

    • Receptor internalization

  • Single-cell analysis: Population-averaged measurements may mask heterogeneous responses. Employ:

    • Single-cell calcium imaging

    • Flow cytometry

    • Live-cell microscopy with biosensors

  • Receptor density considerations: Contradictory findings may result from expression level differences. Control for surface expression using quantitative approaches:

    • Flow cytometry

    • Surface biotinylation

    • Radioligand binding at saturation

  • Experimental design approach: Implement factorial experimental designs that can identify interactions between variables, rather than changing one variable at a time . This approach can reveal complex dependencies that explain seemingly contradictory results.

When publishing findings, report detailed methodological parameters and provide raw data to facilitate cross-laboratory comparison and data integration.

How can structural modeling advance our understanding of Taar7d ligand specificity?

Structural modeling represents a powerful approach to understanding Taar7d ligand specificity and guiding experimental design:

  • Homology modeling foundation: Generate Taar7d structural models based on crystallographic data from related GPCRs such as the β-adrenergic receptor . These models can predict the seven transmembrane α-helical fold and other conserved features of rhodopsin-like GPCRs.

  • Binding pocket analysis: Detailed examination of the putative binding pocket can:

    • Identify critical residues for ligand coordination, particularly the conserved Asp3.32 that forms salt bridges with amine ligands

    • Map the electrostatic and hydrophobic properties of the binding cavity

    • Determine spatial constraints that influence ligand size selectivity

  • Comparative modeling within subfamily: Construct comparative models of Taar7d alongside other TAAR7 subfamily members (e.g., TAAR7e, TAAR7f) to identify subtle structural differences that confer ligand selectivity . Focus particularly on positions 3.37 and 3.38, which are key determinants of ligand specificity in this subfamily.

  • Molecular dynamics simulations: Beyond static models, molecular dynamics can:

    • Reveal binding pocket flexibility

    • Identify water-mediated interactions

    • Simulate conformational changes upon ligand binding

    • Calculate binding free energies for different ligands

  • Structure-guided experimental design: Use modeling insights to design:

    • Rational mutagenesis studies targeting predicted interaction residues

    • Modified ligands that exploit specific binding pocket features

    • Allosteric modulators that bind to sites distinct from the orthosteric pocket

The complementary application of computational modeling and experimental validation creates an iterative process that continually refines our understanding of Taar7d structure-function relationships. When residue positions in transmembrane 3 (particularly positions 3.37 and 3.38) are explored, researchers should expect significant effects on ligand selectivity based on findings in related receptors .

What are the main technical challenges in working with recombinant Taar7d?

Working with recombinant Taar7d presents several technical challenges that researchers should anticipate:

  • Membrane protein expression difficulties: As a seven-transmembrane GPCR, Taar7d presents challenges for heterologous expression systems. Membrane insertion, proper folding, and trafficking can be problematic in non-native environments. Cell-free expression systems may partially address these issues but introduce their own limitations .

  • Protein stability concerns: Membrane proteins often exhibit reduced stability when extracted from lipid environments. This necessitates careful optimization of detergent conditions during purification and may require lipid reconstitution for functional studies .

  • Low expression yields: GPCRs typically express at lower levels than soluble proteins. Optimization of expression parameters (strain, temperature, induction conditions) is critical but may still yield limited quantities .

  • Functional validation complexity: Demonstrating functional activity requires appropriate ligands and coupling partners. For Taar7d, incomplete knowledge of natural ligands and signaling pathways complicates functional validation.

  • Structural characterization challenges: Obtaining high-resolution structural data for GPCRs remains challenging despite recent advances. Crystallization typically requires extensive protein engineering and stabilization.

How can advanced methodologies address knowledge gaps in Taar7d research?

Several advanced methodologies can address critical knowledge gaps in Taar7d research:

  • Cryo-electron microscopy (cryo-EM): This technique can potentially determine Taar7d structure without crystallization requirements that have limited GPCR structural biology. Single-particle cryo-EM can reveal ligand-bound conformations and conformational dynamics.

  • Native mass spectrometry: This approach can characterize Taar7d complexes with interacting proteins and ligands while maintaining non-covalent interactions, providing insights into the composition of signaling complexes.

  • CRISPR-Cas9 genome engineering: Generate knock-in reporter lines to study Taar7d expression patterns in vivo, or create specific mutations to test structure-function hypotheses in native contexts.

  • Single-cell transcriptomics: Profile TAAR-expressing sensory neurons to understand the complete molecular context in which Taar7d functions, including co-expressed signaling components and other receptors.

  • Chemogenetics and optogenetics: Selectively activate or inhibit Taar7d-expressing neurons in vivo to map neural circuits and behavioral outputs, addressing the gap in understanding how "TAAR-expressing sensory neurons engage higher-order neural circuits to encode odor valence" .

  • High-throughput ligand screening: Implement unbiased screens of large compound libraries to identify novel Taar7d ligands, potentially revealing unexpected chemical recognition properties.

These methodologies, applied systematically, can address fundamental questions about Taar7d's structural basis for ligand recognition, signaling mechanisms, and biological functions in the olfactory system.

What experimental design approaches can integrate Taar7d research with broader olfactory system studies?

Integrating Taar7d research with broader olfactory system studies requires experimental designs that bridge molecular, cellular, circuit, and behavioral levels:

  • Circuit tracing methodologies:

    • Implement viral tracing techniques to map projections from Taar7d-expressing neurons to higher brain regions

    • Use trans-synaptic tracers to identify post-synaptic partners

    • Apply multiplexed FISH to characterize molecular identity of connected neurons

  • Functional circuit mapping:

    • Calcium imaging of Taar7d-expressing sensory neurons during odor presentation

    • Simultaneous recording from olfactory bulb glomeruli receiving Taar7d input

    • Whole-brain activity mapping during Taar7d-specific stimulation

  • Integration with behavioral paradigms:

    • Design behavioral assays that isolate Taar7d-mediated responses

    • Implement closed-loop optogenetic manipulation during behavior

    • Compare Taar7d-mediated behaviors with those mediated by adjacent TAARs

  • Comparative experimental design:

    • Conduct parallel studies of Taar7d alongside TAAR4 and TAAR5, which "are encoded by adjacent genes and localize to adjacent glomeruli, yet mediate opposing behaviors"

    • This comparison can reveal principles of how receptor identity maps to valence coding

  • Multidisciplinary approach:

    • Coordinate molecular studies (receptor pharmacology) with neuroanatomical investigations

    • Link receptor activation to neural circuit activation to behavioral outcomes

    • Develop computational models that predict how receptor-level properties influence system-level function

Through experimental designs that systematically connect these levels of analysis, researchers can contextualize Taar7d findings within the broader principles of olfactory system function, contributing to fundamental understanding of sensory coding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.