Recombinant Mouse Trace amine-associated receptor 7f (Taar7f)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Expression

mTAAR7f is produced using heterologous expression systems, optimized for structural studies and ligand-binding assays.

Expression Systems

SystemHost OrganismTags/ModificationsApplicationSource
BaculovirusTrichoplusia ni cellsHA signal, FLAG, His, eGFPCryo-EM studies
E. coliE. coliN-terminal His tagFunctional assays

Key Modifications:

  • TEV/HRV-3C Protease Sites: Facilitate tag removal post-purification .

  • Nanobodies: Stabilize the receptor-G protein complex for cryo-EM .

Ligand Recognition and Activation Mechanism

mTAAR7f binds aversive odorants like N,N-dimethylcyclohexylamine (DMCH) through a distinct mechanism compared to βARs.

Critical Residues in Ligand Binding

Residue (Position)Interaction with DMCHConservation Status
Asp127 3.32Charge interaction with tertiary amineConserved in all TAARs
Trp286 6.48Van der Waals interactions; rotates upon activationRotated vs. β2AR
Tyr316 7.43Stabilizes Asp127 via H-bond; TM7-TM3 interactionConserved in TAARs

Activation Pathway:

  1. Ligand Binding: DMCH enters the hydrophobic pocket, forming van der Waals contacts with Val312 7.39, Val315 7.42, and Trp286 6.48 .

  2. Conformational Changes:

    • Trp286 6.48 rotates, disrupting the inactive-state ionic lock (Arg145 3.50-Asp144 3.49) .

    • TM6 outward movement enables G protein coupling .

  3. G Protein Recruitment: Mini-Gs trimer binds via α5 helix interactions, though fewer contacts exist compared to β2AR .

Functional Studies and Mutagenesis

Mutagenesis experiments validate the roles of critical residues:

MutationEffect on G Protein Coupling (EC50/Emax)Source
D127A 3.32Drastic reduction in coupling
W286Y 6.48Severe impairment; 4.2 Å shift in Trp286
V315A 7.42Loss of DMCH-induced activation

Key Findings:

  • No TM5 Bulge Formation: Unlike βARs, TAARs lack a one-amino-acid deletion in TM5, preventing bulge formation during activation .

  • Conserved Activation Motifs: The PIF motif (Phe282 6.44) adopts an active conformation despite structural constraints .

Functional Assays

  • G Protein Recruitment: Measured via β-galactosidase or luciferase assays in HEK293T cells .

  • Ligand Selectivity: Mutants like Y132C 3.37 reverse ligand preference between mTAAR7f and mTAAR7e .

Comparative Analysis with β2AR

FeaturemTAAR7fβ2AR
Ligand BindingHydrophobic pocket + Asp127 3.32Catecholamine + Ser5.46
Trp6.48 PositionRotated 35° vs. inactive β2ARCanonical active-state conformation
TM5 BulgeAbsent (1-amino-acid deletion)Present
G Protein ContactsFewer α5 helix interactionsExtensive α5 helix interactions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Taar7f; Trace amine-associated receptor 7f; TaR-7f; Trace amine receptor 7f; mTaar7f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Taar7f
Target Protein Sequence
MSIADETVSWNQDSILSRDLFSATSAELCYENLNRSCVRSPYSPGPRLILYAVFGFGAVL AVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGVMVMPFSMVRSVEGCWYFGDSYC KLHTCFDVSFCYCSLFHLCFISVDRYIAVSDPLAYPTRFTASVSGKCITFSWLLSISYGF SLIYTGASEAGLEDLVSSLTCVGGCQIAVNQTWVFINFSVFLIPTLVMITVYSKIFLIAK QQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSFIDAFLG FITPTYVYEILVWIVYYNSAMNPLIYAFFYPWFRKAIKLTVTGKILRENSSTTNLFSE
Uniprot No.

Target Background

Function

Recombinant Mouse Trace amine-associated receptor 7f (Taar7f): An olfactory receptor activated by the trace amine N-methylpiperidine. This receptor is likely mediated by Gs-class G-proteins, which activate adenylate cyclase.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in neurons of the olfactory epithelium.

Q&A

What is mouse Taar7f and what is its biological function?

Mouse Trace amine-associated receptor 7f (mTAAR7f) is a G protein-coupled receptor (GPCR) belonging to the trace amine-associated receptor family. It functions as an olfactory receptor that recognizes specific amine compounds found in urine. These receptors play a critical role in mice by mediating behavioral responses to odors - specifically, mice demonstrate aversive behavior when exposed to certain TAAR7f ligands such as amines found in urine .

The receptor is expressed in olfactory neurons and couples primarily to the heterotrimeric G protein Golf in vivo, which shares significant sequence similarity (77% identity) with Gs protein . This coupling activates downstream signaling pathways that ultimately translate chemical detection into behavioral responses.

What ligands does Taar7f recognize and what is their significance?

Taar7f recognizes specific amine compounds, most notably N,N-dimethylcyclohexylamine (DMCH), which acts as an agonist with an EC50 of approximately 0.5 μM . DMCH binding occurs primarily through charge-charge interactions between its tertiary amine group and Asp127 (position 3.32) in the receptor, along with extensive van der Waals interactions within the hydrophobic orthosteric binding site (OBS) .

These ligands are significant because they trigger either attractive/neutral or aversive behavioral responses in mice . The molecular recognition of these compounds provides insights into how chemical structures are translated into specific behavioral outputs through GPCR signaling mechanisms.

What is known about the structure of mTAAR7f?

The structure of mTAAR7f has been determined using electron cryo-microscopy (cryo-EM) in an active state coupled to the heterotrimeric G protein, Gs . The receptor exhibits the typical seven-transmembrane helix architecture characteristic of Class A GPCRs.

Key structural features include:

  • An orthosteric binding site (OBS) formed by transmembrane helices TM3, TM5, TM6, and TM7, separated from the extracellular environment by extracellular loop 2 (ECL2)

  • A canonical disulfide bond between Cys205 in ECL2 and Cys120 at position 3.25 that helps position ECL2 across the OBS

  • Conserved activation motifs typical of Class A GPCRs, including the P5.50-I3.40-F6.44 motif, the C3.36-W6.48-x-F6.44 motif, the D3.49-R3.50-Y3.51 motif, and the N7.49P7.50xxY7.53 motif

The structure reveals that mTAAR7f's OBS is smaller than typical aminergic receptors and lacks the extracellular access seen in those receptors, suggesting a more specialized and selective binding pocket .

What expression systems are most effective for recombinant mTAAR7f production?

Based on research findings, insect cell expression using the baculovirus expression system has proven highly effective for recombinant mTAAR7f production . Specifically:

  • mTAAR7f was successfully expressed in Trichoplusia ni High Five cells using the Bac-to-Bac expression system (Invitrogen)

  • The receptor was selected from a screen of multiple olfactory receptors due to its high expression levels in insect cells

  • The baculovirus was prepared in Sf9 (Spodoptera frugiperda) cells grown in Sf-900 II medium, with viral titers exceeding 3 × 10^8 viral particles per ml

  • The viral titer was verified using flow cytometry with anti-gp64 conjugated antibodies

For optimal expression, the wild-type mTAAR7f construct included specific modifications: an N-terminal tag system (haemagglutinin signal sequence, FLAG tag, His10 purification tag, and tobacco etch virus cleavage site) and C-terminal modifications (human rhinovirus 3C cleavage site followed by eGFP) . These modifications facilitate both expression and downstream purification while maintaining receptor functionality.

What are the critical steps in purifying recombinant mTAAR7f for structural studies?

Purification of recombinant mTAAR7f requires careful attention to maintaining protein stability. Based on published protocols, the following critical steps should be considered:

  • Initial assessment: Fluorescence-detection size exclusion chromatography (FSEC) is recommended to assess stability after detergent solubilization before proceeding with large-scale purification

  • Expression conditions: Express the receptor in the presence of its agonist (DMCH) to stabilize the receptor during expression and purification

  • Complex formation: For structural studies, form a complex with the appropriate G protein. While mTAAR7f couples to Golf in vivo, researchers have successfully used Gs for structural studies due to the availability of nanobody Nb35 that stabilizes the interface between α and β subunits of the heterotrimeric G protein

  • Detergent selection: Appropriate detergent selection is critical for maintaining receptor stability during purification. The research used detergent solubilization followed by affinity purification

The presence of the agonist throughout the purification process appears to be particularly important for maintaining stability of the receptor in its active conformation .

What are the key residues involved in ligand recognition and binding for mTAAR7f?

Structural and functional studies have identified several key residues involved in ligand recognition and binding for mTAAR7f. The receptor-ligand contacts (≤ 3.9 Å) are mediated by eight amino acid residue side chains:

Aromatic residues:

  • Tyr132 (position 3.37)

  • Trp286 (position 6.48)

  • Tyr289 (position 6.51)

  • Tyr316 (position 7.43)

Hydrophobic residues:

  • Val312 (position 7.39)

  • Val315 (position 7.42)

Polar residues:

  • Asp127 (position 3.32)

  • Asn217 (position 5.42)

Most of these interactions involve van der Waals forces, with a critical exception: the strong polar interaction between Asp127 (position 3.32) and the tertiary amine in DMCH. Molecular dynamics simulations confirmed this interaction was preserved 100% of the time across multiple simulations .

Additionally, three other residues were identified through MD simulations that make contact with the ligand 20-70% of the time:

  • Val128 (position 3.33)

  • Cys131 (position 3.36)

  • Phe290 (position 6.52)

Mutagenesis studies confirmed that modifications to these residues significantly decreased G protein recruitment, validating their importance in ligand binding .

How does the orthosteric binding site of mTAAR7f compare to other receptors?

The orthosteric binding site (OBS) of mTAAR7f shows both similarities and distinct differences when compared to other receptors:

Comparison with aminergic receptors (β2AR, 5-HT4R, 5-HT1R):

Comparison with olfactory receptor OR51E2:

  • Despite both being olfactory receptors, the binding pocket of propionate in OR51E2 and the position of the agonists do not overlap at all with mTAAR7f

  • Both share an occluded architecture but differ significantly in binding site location

The unique features of mTAAR7f's binding site explain its ligand selectivity. For example, the Y132C mutation at position 3.37 was predicted to expand the size of the OBS, allowing binding of bulkier ligands that activate mTAAR7e (which naturally contains Cys at this position). Experiments confirmed this prediction, as the mutation reversed the ligand selectivity of the two receptors .

What is the proposed mechanism for DMCH-induced activation of mTAAR7f?

Based on the active-state structure and comparison with other well-studied GPCRs like β-adrenergic receptors (βARs), a mechanism for DMCH-induced activation of mTAAR7f has been proposed:

  • Initial binding: DMCH binds primarily through charge-charge interactions between its tertiary amine and Asp127 (position 3.32), along with extensive van der Waals interactions with the hydrophobic orthosteric binding site

  • OBS contraction: This binding causes a contraction of the OBS through interactions between DMCH and residues in TM6 and TM7 (Val312 at 7.39, Tyr316 at 7.43, Val315 at 7.42, Tyr289 at 6.51, Trp286 at 6.48)

  • Stabilization of TM3-TM7 interaction: The binding stabilizes the interaction between TM3 and TM7 via a hydrogen bond between Tyr316 (7.43) and Asp127 (3.32)

  • Unique Trp286 rotation: The position of DMCH and Val315 (7.42) causes Trp286 (6.48) to rotate by approximately 35° around the TM6 helical axis compared to its position in β2AR. This rotation is unique to mTAAR7f and results in a 4.2 Å positional difference

  • Activation of downstream motifs: This rotation induces activation of downstream activation motifs (PIF, NPxxY, and DRY)

  • TM6 movement and G protein coupling: Finally, these conformational changes result in the outward movement of TM6, enabling G protein coupling

This mechanism is supported by mutagenesis data and molecular dynamics simulations. Mutations of W286Y (6.48) and Val315 (7.42) both showed low levels of DMCH-induced G protein coupling, consistent with their proposed roles in receptor activation .

How does mTAAR7f activation differ from β-adrenergic receptors?

While mTAAR7f shares many activation characteristics with β-adrenergic receptors (βARs), several key differences exist:

  • Interaction with TM5: Unlike βARs where strong interactions with TM5 are critical, mTAAR7f shows only a weak van der Waals interaction between the agonist and TM5 via Asn217 (position 5.42)

  • Absence of TM5 bulge: A characteristic bulge formation in TM5 that occurs upon ligand activation in βARs is absent in mTAAR7f. Sequence alignments reveal that TAARs have a one amino acid deletion in this region compared to aminergic receptors, preventing TM5 from forming a bulge

  • Position of Trp6.48: In mTAAR7f, Trp286 (position 6.48) adopts an extreme conformation compared to β2AR, with a 35° rotation around the TM6 helical axis. This results in a 4.2 Å difference in position

  • PIF motif differences: While parts of the conserved activation motifs follow canonical patterns, Leu135 (position 3.40) in mTAAR7f cannot adopt the active conformation of Ile3.40 in β2AR due to the position of Trp286 (6.48)

What insights have molecular dynamics simulations provided about mTAAR7f function?

Molecular dynamics (MD) simulations have provided valuable insights into the dynamic behavior of mTAAR7f and its interactions with ligands:

  • Validation of key interactions: MD simulations (5 simulations, 1 μs each, 50,000 snapshots per simulation) confirmed that the critical charge-charge interaction between Asp127 (3.32) and the tertiary amine in DMCH was preserved 100% of the time

  • Identification of transient contacts: While the cryo-EM structure identified eight residues making contact with DMCH, MD simulations revealed that these contacts are present 30-90% of the time, indicating some flexibility in the binding pocket

  • Discovery of additional binding residues: The simulations identified three additional residues that make contact with the ligand 20-70% of the time (Val128 at 3.33, Cys131 at 3.36, Phe290 at 6.52) that were not immediately apparent from the static cryo-EM structure

  • Support for proposed activation mechanism: MD simulations supported the proposed mechanism of receptor activation, particularly the importance of the unique conformation of Trp286 (6.48) and its role in transmitting conformational changes

These computational approaches complement experimental structural and functional studies, providing a more complete understanding of the dynamic processes involved in ligand recognition and receptor activation.

What mutagenesis strategies have been most informative for studying mTAAR7f structure-function relationships?

Several mutagenesis approaches have provided critical insights into mTAAR7f structure-function relationships:

  • Binding site residue mutations: Mutations of residues predicted to make contact with the ligand (from both cryo-EM structure and MD simulations) significantly decreased G protein recruitment, confirming their role in ligand binding and signal transduction. These included mutations to key residues such as D127A (3.32), W286Y (6.48), and Val315 (7.42)

  • Selectivity-determining residue mutations: The Y132C (3.37) mutation was designed based on the hypothesis that it would expand the size of the orthosteric binding site and allow binding of bulkier ligands that activate mTAAR7e (which naturally contains Cys at this position). This mutation successfully reversed the ligand selectivity of the two receptors, confirming the structural basis of ligand specificity

  • Active state stabilizing residue mutations: Mutation of C131A (3.36) significantly decreased agonist-induced G protein coupling, suggesting its importance in maintaining the proper rotamer of Asp127 (3.32) which is critical for ligand binding

These targeted mutagenesis approaches, guided by structural information and computational predictions, have been instrumental in validating the proposed binding and activation mechanisms of mTAAR7f.

How does mTAAR7f compare to other members of the TAAR family?

Comparison of mTAAR7f with other TAAR family members reveals insights into conservation and specialization within this receptor class:

  • Conserved binding site residues: Of the residues in the orthosteric binding site of mTAAR7f, three are absolutely conserved in all murine and human TAARs: Asp127 (3.32), Trp286 (6.48), and Tyr316 (7.43). This suggests these positions are critical for the general function of all TAARs

  • Ligand selectivity determinants: Despite the conservation of key residues, TAARs exhibit selectivity for different ligands. For example, the difference at position 3.37 (Tyr in TAAR7f vs. Cys in TAAR7e) determines ligand selectivity between these receptors, as demonstrated by the Y132C mutation that reversed their selectivity profiles

  • Structural similarities: All TAARs share the characteristic one amino acid deletion in TM5 compared to aminergic receptors, which prevents the formation of a bulge upon activation. This suggests a common activation mechanism distinct from aminergic receptors

The combination of highly conserved elements with specific variations explains how different TAAR subtypes can share a common structural architecture while recognizing distinct ligands and mediating different behavioral responses.

What are the key differences in receptor-ligand interactions between mTAAR7f and other olfactory receptors?

The receptor-ligand interactions of mTAAR7f differ significantly from other olfactory receptors:

  • Binding pocket location: Unlike some other olfactory receptors such as OR51E2, the orthosteric binding site of mTAAR7f overlaps with positions seen in aminergic receptors rather than typical odorant receptors. The binding pocket of propionate in OR51E2 and the position of agonists do not overlap at all with mTAAR7f, despite both having occluded architecture

  • Binding mode: mTAAR7f employs a combination of a strong charge-charge interaction between Asp127 (3.32) and the tertiary amine of DMCH, along with numerous van der Waals interactions. This differs from many conventional odorant receptors where hydrogen bonding and π-π interactions often play more prominent roles

  • Structural features: While both mTAAR7f and conventional odorant receptors belong to the GPCR superfamily, mTAAR7f shares more structural similarities with aminergic receptors in its binding mechanism, though with a smaller and more occluded binding pocket

These differences highlight the specialized nature of TAARs as a distinct subfamily of olfactory receptors that have evolved to recognize specific chemical classes of odorants, particularly amines found in biological fluids like urine .

What are the main technical challenges in working with recombinant mTAAR7f?

Working with recombinant mTAAR7f presents several technical challenges common to membrane proteins and GPCRs:

  • Expression levels: While mTAAR7f was selected for study partly due to its relatively high expression, membrane protein expression generally yields lower amounts of protein compared to soluble proteins

  • Protein stability: Maintaining stability after detergent solubilization is a significant challenge, necessitating careful selection of detergents and buffer conditions

  • Active conformation stabilization: For functional and structural studies, maintaining the receptor in an active conformation requires the presence of both agonist (DMCH) and stabilizing partners like G proteins

  • Purification complexity: The multi-step purification process involving affinity tags, detergent exchanges, and complex formation with G proteins adds technical complexity

  • Structural heterogeneity: Like many GPCRs, mTAAR7f likely exhibits conformational heterogeneity, which can complicate structural studies, particularly cryo-EM analysis

What approaches have been successful in overcoming challenges in structural studies of mTAAR7f?

Several successful approaches have been employed to overcome challenges in structural studies of mTAAR7f:

  • Construct engineering: Addition of carefully designed tags (HA signal sequence, FLAG tag, His10 purification tag, TEV cleavage site at N-terminus; HRV 3C cleavage site and eGFP at C-terminus) facilitated expression, detection, and purification

  • Expression system optimization: Use of the baculovirus expression system in insect cells (particularly Trichoplusia ni High Five cells) with high-titer viral stocks (>3 × 10^8 viral particles per ml) maximized protein yield

  • Stability assessment: Implementation of fluorescence-detection size exclusion chromatography (FSEC) allowed rapid assessment of protein stability after detergent solubilization, enabling efficient screening of conditions

  • Complex formation strategy: While mTAAR7f couples to Golf in vivo, researchers successfully used Gs for structural studies due to the availability of nanobody Nb35 that stabilizes the G protein complex. This strategy took advantage of the high sequence similarity (77% identity) between Golf and Gs

  • Complementary approaches: Integration of structural data (cryo-EM), computational methods (MD simulations), and functional validation (mutagenesis and activity assays) provided a comprehensive understanding of receptor function

These approaches collectively enabled successful structural determination and functional characterization of mTAAR7f in its active state, providing insights into its mechanism of action.

What aspects of mTAAR7f function remain to be elucidated?

Despite significant advances in understanding mTAAR7f structure and function, several important aspects remain to be fully elucidated:

  • Inactive state structure: The current structural data is limited to the active state of mTAAR7f bound to DMCH and coupled to Gs. An inactive state structure would provide valuable insights into the conformational changes associated with activation

  • Ligand diversity: While DMCH is a known agonist, the full spectrum of natural and synthetic ligands that can activate or inhibit mTAAR7f remains to be thoroughly characterized

  • Downstream signaling pathways: The specific intracellular signaling pathways activated by mTAAR7f in olfactory neurons and how these translate to behavioral responses require further investigation

  • Interplay with other olfactory receptors: How mTAAR7f-mediated signaling integrates with other olfactory receptors to shape complex odor perception and behavioral responses is not fully understood

  • Species differences: Comparative studies of TAAR7f across species could provide evolutionary insights into the diversification of olfactory recognition mechanisms

What new methodologies might advance our understanding of mTAAR7f?

Several emerging methodologies hold promise for advancing our understanding of mTAAR7f:

  • Cryo-EM advances: Continued improvements in cryo-EM technology may enable higher-resolution structures and capture of conformational intermediates or the inactive state

  • Time-resolved structural methods: Techniques that capture conformational changes in real-time could provide insights into the dynamics of receptor activation

  • Advanced computational approaches: Enhanced molecular dynamics simulations with longer timescales and improved force fields could better model the conformational changes and energetics of receptor activation

  • In vivo functional imaging: Advanced neural imaging techniques could help correlate receptor activation with neural circuit responses and behavioral outputs

  • Single-molecule methods: Techniques like single-molecule FRET could capture conformational dynamics of individual receptor molecules during ligand binding and activation

  • Structure-based drug design: Computational approaches leveraging the existing structural data could facilitate the development of selective modulators of mTAAR7f activity for research tools and potential therapeutic applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.