Recombinant Mouse Trace amine-associated receptor 8c (Taar8c)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Taar8c

Recombinant Mouse Taar8c is a protein expressed from the Taar8c gene in mouse (Mus musculus). It belongs to the trace amine-associated receptor family, which are G protein-coupled receptors that recognize trace amines and other compounds. Recombinant Taar8c is typically produced in mammalian cell expression systems to maintain proper folding and post-translational modifications essential for its structure and function . The protein can be expressed either as a full-length protein or as partial length variants depending on research requirements.

Commercial preparations of recombinant mouse Taar8c are available in various forms, including liquid solutions or lyophilized powder, with high purity levels typically exceeding 80% . These preparations often include various tags, such as His-tags, to facilitate purification and detection in experimental settings. The production of recombinant Taar8c typically requires custom synthesis with lead times ranging between 5-9 weeks, highlighting the specialized nature of this protein's production .

Physical and Biochemical Properties

Commercially available recombinant mouse Taar8c preparations typically demonstrate the following properties:

PropertySpecification
FormLiquid or lyophilized powder
Endotoxin Level< 1.0 EU per μg (LAL method)
Purity>80%
Storage BufferPBS buffer
TagHis (common)
SourceMammalian Cells

Table 1: Physical and biochemical properties of recombinant mouse Taar8c protein .

Genetic Profile

The mouse Taar8c gene is well-characterized at the genetic level. Key genetic information about Taar8c includes:

ParameterInformation
Gene NameTaar8c trace amine-associated receptor 8C
Official SymbolTAAR8C
Gene ID494546
mRNA RefseqNM_001010840.2
Protein RefseqNP_001010840.1
UniProt IDQ5QD05

Table 2: Genetic information for mouse Taar8c .

Expression Patterns

While the search results don't provide specific information about the natural expression patterns of mouse Taar8c, studies on TAARs in general indicate variable expression across different tissues. In humans, TAAR expression has been studied in various contexts, including primary and metastatic tumors, where expression levels can range significantly . For instance, TAAR expression levels in metastatic tumor samples have been observed to vary from 0 to 21.6 CPM (counts per million), while in circulating tumor cells (CTCs), they ranged from 0 to 111.51 CPM .

Signaling Pathways

Trace amine-associated receptors are known to function through G protein-coupled signaling pathways. While specific information about mouse Taar8c signaling is limited in the search results, related research on TAAR8 indicates involvement in important cellular signaling mechanisms. In humans, TAAR8 is notably the only trace amine-associated receptor known to be G₁/ₒ-coupled , suggesting a role in inhibitory signaling pathways.

Research has demonstrated that TAAR8 plays a role in the cAMP-PKA signaling pathway, particularly in the context of migrasome formation . This suggests that Taar8c might similarly participate in cAMP-dependent signaling cascades, though further research is needed to confirm the specific signaling mechanisms in mouse models.

Role in Migrasome Formation

One of the most significant functions of TAAR8 identified in recent research is its role in migrasome formation. Migrasomes are cellular structures formed during cell migration that contain various bioactive molecules. Research has shown that TAAR8 mediates increased migrasome formation in response to cadaverine, a biogenic amine .

When TAAR8 was knocked down in cells, the cadaverine-induced increase in migrasomes was inhibited . Specifically, compared to cadaverine-treated cells with normal TAAR8 expression, TAAR8-silenced cells showed:

  1. Decreased number of migrasomes per cell

  2. Reduced migrasome diameter

  3. Lower percentage of migrasome-containing cells

These findings suggest that TAAR8 serves as a key regulator of migrasome formation, functioning as a target protein for cadaverine . While this research wasn't specifically conducted on mouse Taar8c, the functional conservation among TAARs suggests that mouse Taar8c might play similar roles in migrasome biology.

Experimental Uses

Recombinant mouse Taar8c protein has various applications in research settings:

  1. Receptor-Ligand Interaction Studies: The protein can be used to investigate binding affinities and interactions with various ligands, including trace amines and other compounds.

  2. Antibody Production: As an immunogen for developing specific antibodies against Taar8c for research applications.

  3. Functional Assays: In cellular assays to study receptor activation, signaling pathways, and downstream effects.

  4. Structure-Function Relationship Studies: To understand the structural determinants of ligand recognition and receptor activation.

Experimental Conditions

When working with recombinant mouse Taar8c, specific experimental conditions are recommended to maintain protein functionality:

  1. Reconstitution: For lyophilized preparations, reconstitution in PBS buffer is typically recommended .

  2. Working Concentrations: Optimal concentrations vary depending on the specific application but should be determined empirically.

  3. Storage Conditions: Short-term storage at +4°C and long-term storage at -20°C to -80°C to maintain protein stability .

  4. Avoiding Freeze-Thaw Cycles: Repeated freeze-thaw cycles should be avoided to prevent protein degradation.

TAAR8 and Cadaverine Interactions

Recent research has identified significant interactions between TAAR8 and cadaverine, with important implications for cellular function. A notable study demonstrated that cadaverine and putrescine bind to TAAR8 and influence various physiological processes, including cell migration . This binding interaction was found to enhance migrasome formation, highlighting a previously unrecognized role for TAAR8 in cellular processes.

When TAAR8 was silenced in cells treated with cadaverine, researchers observed a significant inhibition of migrasome formation, confirming TAAR8's essential role in this process . This research provides valuable insights into the molecular mechanisms by which TAAR8 and cAMP-PKA signaling pathways influence migrasome formation, suggesting potential new avenues for research on mouse Taar8c.

Expression in Disease States

While not specific to mouse Taar8c, research on human TAARs has revealed interesting patterns of expression in various disease states, particularly in cancer. Analysis of transcriptomic data has shown that all known TAARs are expressed in breast cancer tissues, including both primary tumors and metastatic lesions .

Expression levels of TAARs in primary tumor samples were found to vary from 0 to 243.13 CPM, while in metastatic tumor samples, expression ranged from 0 to 21.6 CPM . In circulating tumor cells, TAAR expression varied from 0 to 111.51 CPM . Interestingly, TAAR expression in primary tumors appeared to be more pronounced than in metastatic lesions or circulating tumor cells, though this observation requires further statistical validation due to potential batch effects .

These findings suggest that TAARs, potentially including mouse Taar8c homologs, may play roles in disease processes and could be worthy of investigation as potential biomarkers or therapeutic targets.

Evolutionary Conservation

Trace amine-associated receptors are found across various species, suggesting evolutionary conservation of their functions. The specific evolutionary relationships between mouse Taar8c and other TAARs, both within mouse and across species, would require detailed phylogenetic analysis not provided in the search results.

Potential Therapeutic Applications

Given the involvement of TAARs in various physiological processes and potential disease associations, future research could explore the therapeutic potential of targeting mouse Taar8c or its human counterparts. Potential areas for investigation include:

  1. Modulators of Migrasome Formation: Since TAAR8 mediates migrasome formation in response to cadaverine , compounds that modulate this interaction could have potential applications in contexts where migrasomes play important roles.

  2. Disease Biomarkers: The variable expression of TAARs in disease states, particularly in cancer , suggests potential applications as biomarkers for disease progression or treatment response.

  3. Novel Therapeutic Targets: Understanding the signaling pathways and downstream effects of Taar8c activation could reveal opportunities for therapeutic intervention in conditions where these pathways are dysregulated.

Technical Advancements in Protein Production

Current methods for producing recombinant mouse Taar8c often require custom synthesis with lead times of 5-9 weeks , suggesting opportunities for technical improvements. Future research could focus on:

  1. Optimized Expression Systems: Developing more efficient expression systems for producing higher yields of functional recombinant Taar8c.

  2. Improved Purification Methods: Refining purification protocols to enhance protein purity and maintain structural integrity.

  3. Stabilization Strategies: Investigating novel approaches to improve the stability of recombinant Taar8c under various experimental conditions.

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Taar8c; Trace amine-associated receptor 8c; TaR-8c; Trace amine receptor 8c; mTaar8c
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Taar8c
Target Protein Sequence
MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVYGFGAVLAVCGNLLVVISVLHFK QLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSAL HLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLV SALNCVGGCQVVVNQDWVLISFLLFFIPTVVMIILYSKIFLVAKQQAVKIETSVSGNRGE SSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDALVDAFMGFITPAYVYEICCWS AYYNSAMNPLIYAFFYPWFRKAIKLILSGKILKGHSSTTNLFSE
Uniprot No.

Target Background

Function
Orphan olfactory receptor specific for trace amines.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in neurons of the olfactory epithelium.

Q&A

What expression systems are recommended for producing recombinant mouse TAAR8C?

The optimal expression system depends on your specific research requirements:

Expression SystemAdvantagesLimitationsApplications
HEK-293 CellsNative-like post-translational modifications, proper folding of mammalian proteinsHigher cost, longer production timeFunctional studies, binding assays, structural analysis
Cell-free protein synthesis (CFPS)Rapid production, avoids cell toxicity issuesMay have lower yields, limited post-translational modificationsPreliminary characterization, antibody production
E. coliHigh yield, cost-effectiveLimited post-translational modifications, potential inclusion body formationImmunization, antibody generation

For studies requiring properly folded and functionally active TAAR8C, mammalian expression systems such as HEK-293 cells are recommended as they provide the appropriate cellular machinery for post-translational modifications and proper protein folding .

How should I design experiments to characterize TAAR8C binding properties?

When designing experiments to characterize TAAR8C binding properties, consider the following methodological approach:

  • Define variables clearly:

    • Independent variable: Concentration range of potential ligands

    • Dependent variable: Binding affinity (measured via appropriate assays)

    • Control variables: Temperature, pH, buffer composition

  • Choose appropriate binding assays:

    • Radioligand binding assays

    • FRET/BRET-based proximity assays

    • Surface plasmon resonance (SPR)

  • Implement proper controls:

    • Positive controls: Known TAAR family ligands (trace amines)

    • Negative controls: Non-binding compounds

    • Vehicle controls: Buffer-only conditions

  • Data analysis considerations:

    • Generate saturation binding curves

    • Calculate Kd values

    • Perform statistical analysis to establish significance

Consider using a systematic screening approach, testing trace amines and related compounds in concentration ranges of 0.1 nM to 100 μM to establish complete dose-response relationships.

What are the key considerations when designing knockout or mutation studies for TAAR8C?

When designing TAAR8C knockout or mutation studies, implement these critical methodological considerations:

  • CRISPR-Cas9 gene editing approach:

    • Design sgRNAs targeting conserved regions of the TAAR8C gene

    • Screen for minimal off-target effects

    • Consider targeting regions common to all isoforms

  • Mutation strategy options:

    • Complete gene knockout (large deletion)

    • Truncated protein expression (frameshift mutation)

    • Point mutations in key functional domains

    • Domain swapping with other TAAR family members

  • Validation of genetic modifications:

    • Sequence verification of modifications

    • Expression analysis (mRNA and protein levels)

    • Functional characterization

  • Experimental controls:

    • Use heterozygous animals as intermediate phenotype controls

    • Include wild-type littermates as baseline controls

    • Consider using tissue-specific or inducible systems for temporal control

For rigorous validation, backcross modified mice at least twice to establish germline transmission and breeding to homozygosity for experimental use, as demonstrated in successful TAAR-related gene editing studies .

How should I approach contradictory results between different TAAR8C functional assays?

When encountering contradictory results between different TAAR8C functional assays, implement this systematic resolution approach:

  • Data examination and discrepancy identification:

    • Thoroughly examine all raw data from each assay

    • Identify specific points of contradiction

    • Check for outliers that may skew results

  • Methodological reconciliation:

    • Compare experimental conditions between assays (temperature, pH, buffer composition)

    • Evaluate the sensitivity and dynamic range of each assay

    • Consider whether assays measure different aspects of receptor function

  • Integrated analysis framework:

    • Implement mixed methods analysis to integrate quantitative and qualitative data

    • Create a reciprocal dialogue between different data types

    • Consider how differences in timeframes or specific conditions might explain discrepancies

  • Experimental validation:

    • Design confirmatory experiments specifically addressing the contradiction

    • Use orthogonal techniques to verify key findings

    • Consider whether the contradiction reveals novel biology worth investigating

Remember that contradictions often lead to deeper understanding of complex biological systems. As noted in mixed methods research, "the process of engaging with divergent results can yield a more comprehensive and nuanced understanding of the situation under study, offering multiple viewpoints" .

What strategies help resolve discrepancies between in vitro and in vivo TAAR8C functional data?

When faced with discrepancies between in vitro and in vivo TAAR8C data, apply these reconciliation strategies:

  • Systematic comparison of experimental contexts:

    • Analyze differences in protein expression levels between systems

    • Evaluate presence/absence of interacting proteins in different environments

    • Consider physiological factors present in vivo but absent in vitro (circulating hormones, neuronal inputs)

  • Methodological refinement:

    • Develop more physiologically relevant in vitro systems (organoids, co-culture)

    • Implement more sensitive in vivo measurement techniques

    • Design experiments that bridge the gap between systems (ex vivo preparations)

  • Hypothesis reformulation:

    • Generate new hypotheses that account for both sets of observations

    • Consider whether TAAR8C functions differently in specific cellular contexts

    • Explore potential compensatory mechanisms present in vivo

  • Validation through complementary approaches:

    • Use pharmacological tools alongside genetic approaches

    • Implement both gain-of-function and loss-of-function studies

    • Consider temporal aspects (acute vs. chronic effects)

This integrated approach recognizes that "reconciling apparent incongruities can yield rich insights into both the nature of the phenomena and of the methods used to investigate them" .

What are the most effective methods for characterizing TAAR8C signaling pathways?

For comprehensive characterization of TAAR8C signaling pathways, implement these methodological approaches:

  • G protein coupling determination:

    • BRET/FRET-based G protein activation assays

    • [35S]GTPγS binding assays

    • Measurement of second messengers (cAMP, Ca2+, IP3)

    • Pathway-specific inhibitor studies

  • Arrestin recruitment and receptor internalization:

    • Bioluminescence resonance energy transfer (BRET) assays

    • High-content imaging of receptor trafficking

    • Flow cytometry for quantitative internalization assessment

  • Downstream signaling pathway analysis:

    • Western blotting for phosphorylated signaling proteins

    • Transcriptional reporter assays

    • Phosphoproteomic analysis

    • RNA-seq for transcriptional effects

  • Temporal dynamics assessment:

    • Real-time signaling measurements

    • Desensitization/resensitization kinetics

    • Persistent signaling after receptor internalization

For G protein coupling studies, it's recommended to evaluate coupling to multiple G protein subtypes (Gαs, Gαi/o, Gαq/11, Gα12/13) as trace amine-associated receptors can couple to multiple pathways with different efficacies depending on the ligand .

How can I optimize cross-species comparability when studying TAAR8C?

To optimize cross-species comparability in TAAR8C research, employ these methodological strategies:

  • Phylogenetic analysis-based approach:

    • Conduct thorough sequence alignments between species

    • Identify highly conserved versus divergent regions

    • Focus functional studies on conserved domains first

  • Standardized expression systems:

    • Express receptors from different species in identical cellular backgrounds

    • Maintain consistent expression levels through rigorously controlled promoter systems

    • Verify proper trafficking to the cell surface in each system

  • Comparative pharmacology:

    • Test identical ligand panels across species orthologs

    • Generate complete concentration-response curves

    • Calculate and compare pharmacological parameters (EC50, Emax)

  • Structure-function relationship studies:

    • Identify species-specific amino acid differences in binding pockets

    • Create chimeric receptors to map functional domains

    • Use site-directed mutagenesis to introduce specific cross-species substitutions

Be aware that substantial functional differences may exist between species. For example, the phylogenetic analysis of TAAR genes reveals that while mouse has multiple functional TAAR8 paralogs (TAAR8a, TAAR8b, TAAR8c), some species have fewer functional orthologs or even pseudogenes, making direct comparisons challenging .

What are the optimal storage and handling conditions for recombinant TAAR8C protein?

For optimal stability and functionality of recombinant TAAR8C protein, follow these evidence-based storage and handling guidelines:

ParameterRecommended ConditionsRationale
Storage Temperature-80°C for long-term storagePrevents protein degradation and maintains structural integrity
AliquotingStore in small single-use aliquotsMinimizes freeze-thaw cycles that can cause denaturation
Buffer CompositionTris buffer with stabilizing agents (specific composition may vary by manufacturer)Maintains proper protein folding and prevents aggregation
ReconstitutionReconstitute lyophilized protein at 200 μg/mL in sterile PBSEnsures proper solubilization while maintaining physiological conditions
Working TemperatureKeep on ice when thawed for useMinimizes degradation during experimental procedures

Critically, avoid repeated freeze-thaw cycles as they significantly impair protein integrity. For carrier-free preparations, particularly stringent handling may be necessary as they lack the stabilizing effect of carrier proteins like BSA .

What are the major challenges in developing selective antibodies against TAAR8C?

Developing selective antibodies against TAAR8C presents several methodological challenges that must be addressed through strategic approaches:

  • Receptor family homology challenges:

    • High sequence similarity between TAAR8C and other TAAR family members

    • Need to identify unique epitopes specific to TAAR8C

    • Solution: Target the N-terminal region or extracellular loops where sequence diversity is greatest

  • Expression and purification considerations:

    • TAAR8C is a membrane protein, making it difficult to produce in native conformation

    • Solution: Use properly folded recombinant fragments or synthetic peptides corresponding to extracellular domains

  • Validation strategy:

    • Implement rigorous validation using TAAR8C knockout tissues as negative controls

    • Perform cross-reactivity testing against other TAAR family members

    • Validate antibodies across multiple applications (Western blot, immunohistochemistry, ELISA)

  • Hybridoma selection approach:

    • Immunize with pools of antigens and clone functionally rearranged light and heavy chains

    • Screen for formalin-resistant epitopes for use in fixed tissues

    • Consider using recombinant antibody technology for improved consistency

For recombinant antibody production, a rapid screening method using small numbers of hybridoma cells can significantly accelerate the selection process for high-quality monoclonal antibodies with the desired specificity .

What statistical approaches are most appropriate for analyzing TAAR8C functional data?

When analyzing TAAR8C functional data, implement these statistical approaches based on experimental design and data characteristics:

  • For dose-response relationships:

    • Nonlinear regression to calculate EC50/IC50 values

    • Compare curves using extra sum-of-squares F test

    • Consider using operational models (e.g., Black-Leff) for efficacy and potency parameters

    • Analyze bias with equiactive comparisons between pathways

  • For knockout/mutation studies:

    • ANOVA with appropriate post-hoc tests for multi-group comparisons

    • Mixed-effects models for repeated measures designs

    • Consider non-parametric alternatives if assumptions are violated

  • For complex experimental designs:

    • Factorial ANOVA to analyze multiple independent variables

    • Be explicit about the statistical design vs. study design distinction

    • Example: A 2×2×3 factorial design with time (pretest/posttest), experience (novice/advanced), and treatment might be analyzed as a 2×3 factorial with experience and treatment as factors and a dependent variable derived from the time points

  • For reconciling mixed methods data:

    • Implement integrated analysis frameworks

    • Triangulate findings from different methodological approaches

    • Consider how differences in measurement timeframes might explain discrepancies

Always clearly define your dependent and independent variables and ensure your statistical approach aligns with your experimental design. Remember that "a single design statement, usually a statistical design statement, would not communicate which data were collected or how" .

How should I approach the interpretation of unexpected results in TAAR8C research?

When encountering unexpected results in TAAR8C research, implement this structured interpretive framework:

  • Initial data verification:

    • Thoroughly examine all data for experimental artifacts or technical issues

    • Verify reagent quality (especially recombinant proteins and antibodies)

    • Repeat key experiments with appropriate controls

  • Hypothesis reassessment:

    • Consider whether the unexpected results challenge existing assumptions about TAAR8C

    • Formulate alternative hypotheses that accommodate both expected and unexpected findings

    • Design targeted experiments to test these new hypotheses

  • Methodological evaluation:

    • Assess whether methodological limitations could explain the unexpected results

    • Consider whether the assays used are measuring what you intend them to measure

    • Implement orthogonal approaches to verify key findings

  • Contextual integration:

    • Place findings within broader context of TAAR family research

    • Consider whether unexpected results align with findings for related receptors

    • Explore whether species differences or isoform specificity might explain results

Remember that unexpected results often lead to scientific breakthroughs. "When you encounter a situation where your results differ from those of your colleagues, it's crucial to approach the discrepancy with a blend of curiosity and skepticism" . This mindset fosters innovative thinking and can lead to significant advances in understanding TAAR8C biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.