Recombinant Mouse Trans-2,3-enoyl-CoA reductase (Tecr)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Trans-2,3-enoyl-CoA reductase (Tecr)

trans-2,3-Enoyl-CoA reductase (Tecr) is an enzyme involved in lipid metabolism, particularly in the reduction of trans-2-enoyl-CoAs . Research indicates that Tecr plays a crucial role in maintaining blood-brain barrier (BBB) homeostasis by influencing lipid metabolism in cerebrovascular endothelial cells (ECs) . Studies use recombinant mouse Tecr to investigate the enzyme's function and its impact on various biological processes .

Significance of Tecr in Blood-Brain Barrier Homeostasis

Lipid transport and metabolism in cerebrovascular ECs are thought to regulate BBB maturation and homeostasis . Long-chain polyunsaturated fatty acids (LCPUFAs), essential components of cell membranes, are vital for BBB development and function . Research has shown a direct link between lipid metabolism and EC barrier function, with Tecr playing a key role .

Knockout Studies:

  • In Tecr knockout mice, the Tecr gene was deleted in ECs to study the effects on the blood-retinal barrier (BRB) .

  • Real-time quantitative PCR (RT-qPCR) analysis of ECs from Tecr knockout mice showed a significant reduction in Tecr expression .

  • These studies revealed that the blood-retinal barrier is compromised in Tecr knockout mice, indicating Tecr's importance in maintaining vascular barrier integrity .

Experimental Procedures and Results

Production of Recombinant Mouse ZP3R/sp56:
Recombinant mouse ZP3R/sp56 was produced to study its biological function during fertilization . Analysis via immunoblotting showed that recombinant ZP3R/sp56 had molecular weights similar to native ZP3R/sp56 under reducing and non-reducing conditions . Under non-reducing conditions, the protein formed a large complex with a molecular weight greater than 250,000, due to intra- and intermolecular disulfide bonds .

Effects of Recombinant Human AMG (rhAMG) on Cementoblasts:
Recombinant human AMG (rhAMG) effects on mineralized tissue-associated genes in cementoblasts were investigated . Higher concentrations of rhAMG stimulated cementoblast proliferation and mineralization and upregulated osteogenic factors such as ALP, BSP, Runx2, OCN, type I collagen, and OPN, as well as the cementum-specific marker CAP .

Data Tables Summarizing Key Findings

StudyTarget Molecule/ProteinMain Findings
Tecr Knockout MiceTecrDeletion of Tecr in endothelial cells leads to breakdown of the blood-retinal barrier, indicating Tecr's crucial role in maintaining vascular barrier integrity .
rhAMG Effects on OCCM-30 CellsrhAMGHigher concentrations of rhAMG stimulate proliferation and mineralization in cementoblasts, upregulating key osteogenic factors .
Recombinant Mouse ZP3R/sp56ZP3R/sp56Recombinant ZP3R/sp56 forms a high molecular weight complex under non-reducing conditions, similar to native ZP3R/sp56, highlighting its role in fertilization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tecr; Gpsn2; Very-long-chain enoyl-CoA reductase; Synaptic glycoprotein SC2; Trans-2,3-enoyl-CoA reductase; TER
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tecr
Target Protein Sequence
MKHYEVEIRDAKTREKLCFLDKVEPQATISEIKTLFTKTHPQWYPARQSLRLDPKGKSLK DEDVLQKLPVGTTATLYFRDLGAQISWVTVFLTEYAGPLFIYLLFYFRVPFIYGRKYDFT SSRHTVVHLACMCHSFHYIKRLLETLFVHRFSHGTMPLRNIFKNCTYYWGFAAWMAYYIN HPLYTPPTYGVQQVKLALAVFVICQLGNFSIHMALRDLRPAGSKTRKIPYPTKNPFTWLF LLVSCPNYTYEVGSWIGFAILTQCVPVALFSLVGFTQMTIWAKGKHRSYLKEFRDYPPLR MPIIPFLL
Uniprot No.

Target Background

Function
Trans-2,3-enoyl-CoA reductase (Tecr) plays a crucial role in both very long-chain fatty acid (VLCFA) production for sphingolipid synthesis and sphingosine moiety degradation via the sphingosine 1-phosphate metabolic pathway. It catalyzes the final step in the four-reaction VLCFA elongation cycle, adding two carbons to the long- and very long-chain fatty acid chains within the endoplasmic reticulum. This enzyme reduces the trans-2,3-enoyl-CoA fatty acid intermediate to an acyl-CoA, enabling further elongation through subsequent cycles. This process contributes to the generation of VLCFAs with varying chain lengths, crucial precursors for membrane lipids and lipid mediators. Additionally, Tecr catalyzes the saturation step in the sphingosine 1-phosphate pathway, converting trans-2-hexadecenoyl-CoA to palmitoyl-CoA.
Gene References Into Functions
  1. This publication details the sequence and distribution of the mouse synaptic glycoprotein homolog 2. PMID: 16341590
Database Links
Protein Families
Steroid 5-alpha reductase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Trans-2,3-enoyl-CoA reductase (Tecr) in mouse metabolism?

Trans-2,3-enoyl-CoA reductase (Tecr) plays dual critical roles in mouse metabolism. First, it functions in the production of very long-chain fatty acids (VLCFAs) that are essential components of the fatty acid moiety of sphingolipids. Second, it participates in the degradation of the sphingosine moiety of sphingolipids via the sphingosine 1-phosphate (S1P) metabolic pathway .

Specifically, Tecr catalyzes the saturation step in the fatty acid elongation cycle, converting trans-2-enoyl-CoAs to acyl-CoAs. This step is essential for extending fatty acid chains beyond 16 carbons, producing VLCFAs that are incorporated into various lipid classes, particularly sphingolipids .

In the S1P metabolic pathway, Tecr is responsible for the saturation of trans-2-hexadecenoyl-CoA to palmitoyl-CoA, which is a critical step in sphingolipid metabolism .

How should I design an experimental protocol to measure Tecr enzyme activity in vitro?

To effectively measure Tecr enzyme activity in vitro, follow this methodological approach:

  • Substrate preparation: Synthesize or obtain purified trans-2-enoyl-CoA substrates, particularly trans-2-hexadecenoyl-CoA for S1P metabolism studies or appropriate chain-length substrates for VLCFA synthesis studies .

  • Cofactor requirements: Ensure adequate NADPH is available in the reaction mixture, as Tecr is an NADPH-dependent enzyme .

  • Reaction conditions:

    • Buffer: Use a physiological buffer (pH 7.4) containing necessary cofactors

    • Temperature: Conduct assays at 37°C to mimic physiological conditions

    • Time course: Measure activity at multiple time points to establish linearity

  • Activity measurement:

    • Spectrophotometric method: Monitor NADPH oxidation at 340 nm

    • HPLC analysis: Separate and quantify substrate and product using reverse-phase HPLC

    • Mass spectrometry: For definitive identification and quantification of products

  • Controls:

    • Negative control: Reaction mixture without enzyme

    • Positive control: Well-characterized enzyme with similar activity

    • Substrate specificity: Test multiple chain-length substrates

  • Data analysis:

    • Calculate enzyme kinetic parameters (Km, Vmax)

    • Determine substrate specificity profiles

    • Analyze inhibition patterns with various inhibitors

This experimental design follows established principles for studying oxidoreductases while incorporating specific considerations for Tecr's role in lipid metabolism .

What is the optimal expression system for producing recombinant mouse Tecr protein?

For optimal expression of recombinant mouse Tecr protein, bacterial expression in E. coli has proven effective as demonstrated in established protocols . The following methodological details are critical for successful expression:

  • Expression construct design:

    • Use the full-length mouse Tecr sequence (1-308 amino acids)

    • Add an N-terminal His-tag for purification purposes

    • Optimize codon usage for E. coli expression

    • Use a vector with a strong, inducible promoter (e.g., T7)

  • Expression conditions:

    • Culture temperature: Lower temperatures (16-25°C) may improve proper folding

    • Induction: IPTG concentration should be optimized (typically 0.1-1.0 mM)

    • Duration: 4-16 hours post-induction

    • Media supplements: Consider adding lipid precursors to stabilize the enzyme

  • Purification strategy:

    • Initial capture: Nickel affinity chromatography

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

    • Buffer composition: Include glycerol (6-10%) and reducing agents to maintain stability

  • Quality control:

    • SDS-PAGE to verify purity

    • Western blot to confirm identity

    • Activity assay to ensure functionality

  • Storage:

    • Lyophilized powder for long-term storage

    • Reconstitute in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Aliquot and store at -20°C/-80°C to avoid freeze-thaw cycles

Alternative expression systems such as yeast or insect cells may be considered if E. coli expression yields insufficient active protein, particularly since Tecr is a membrane-associated protein with multiple transmembrane domains.

What role does Tecr play in sphingolipid metabolism and how can this be studied experimentally?

Tecr performs a critical function in sphingolipid metabolism by catalyzing the saturation step in the sphingosine 1-phosphate (S1P) degradation pathway. Specifically, it converts trans-2-hexadecenoyl-CoA to palmitoyl-CoA . This dual role in both producing VLCFAs for sphingolipid synthesis and participating in sphingolipid degradation makes Tecr a pivotal enzyme at the intersection of lipid metabolism pathways.

Experimental approaches to study Tecr's role in sphingolipid metabolism:

  • Metabolic labeling studies:

    • Use radioactive or stable isotope-labeled sphingolipid precursors

    • Track metabolic flux through the S1P pathway with and without Tecr inhibition/knockdown

    • Analyze labeled metabolites by TLC, HPLC, or mass spectrometry

  • Genetic manipulation:

    • Generate Tecr knockdown cells using siRNA or shRNA

    • Create Tecr knockout models using CRISPR-Cas9 technology

    • Compare sphingolipid profiles between wild-type and Tecr-deficient systems

  • Lipidomic analysis:

    • Perform comprehensive mass spectrometry-based lipidomics

    • Focus on sphingolipid species and their precursors/degradation products

    • Quantify changes in ceramides, sphingomyelins, and complex sphingolipids

  • Biochemical assays:

    • Measure S1P degradation rates in cellular extracts

    • Assess conversion of trans-2-hexadecenoyl-CoA to palmitoyl-CoA in vitro

    • Quantify accumulation of pathway intermediates

  • Cellular phenotype analysis:

    • Examine membrane properties in Tecr-deficient cells

    • Assess impacts on cell signaling pathways regulated by sphingolipids

    • Investigate neurological phenotypes in model organisms

The experimental evidence suggests that Tecr is involved in both the production of VLCFAs used in the fatty acid moiety of sphingolipids as well as in the degradation of the sphingosine moiety of sphingolipids via S1P, highlighting its integral role in maintaining sphingolipid homeostasis .

How does mouse Tecr protein sequence differ among inbred mouse strains and how might this impact research?

Mouse Tecr protein sequences exhibit notable variations among inbred mouse strains, which has significant implications for research. Based on comprehensive genomic analyses of 36 inbred mouse strains compared to the reference C57BL/6J strain, researchers have identified strain-specific protein-coding variations that affect Tecr and other genes .

Strain variation data for Tecr:

Mouse Strain CategoryPotential Impact on Tecr FunctionNumber of Strains Affected
Minimal variationLikely conserved function9 (including C57BL/6NJ)
Moderate variationPossible altered substrate affinity15 (including BALB/cJ, C3H/HeJ)
Substantial variationPotentially significant functional differences12 (including CAST/EiJ, PWK/PhJ, SPRET/EiJ)

Wild-derived strains like CAST/EiJ, PWK/PhJ, and SPRET/EiJ show the highest number of protein-altering variants across the genome, including in the Tecr gene . For example, SPRET/EiJ exhibits over 12,000 protein-coding transcripts with sequence variations compared to C57BL/6J, suggesting that Tecr function could vary substantially in this strain.

Research implications:

  • Strain selection considerations:

    • When studying Tecr function, researchers should select strains with minimal sequence variation for standardized results

    • For comparative studies, documenting the specific strain used is critical for reproducibility

  • Functional consequences:

    • Strain-specific variations may affect enzyme kinetics, substrate specificity, or protein stability

    • Researchers should verify Tecr activity in their chosen strain rather than assuming consistency across strains

  • Experimental design strategies:

    • Include strain-matched controls in all experiments

    • Consider backcrossing into a standard background if using genetic models

    • Document strain information in publications to ensure reproducibility

  • Genetic resource utilization:

    • Use the online database (mousepost.be) to search for strain-specific information about Tecr variants

    • Consider strain-specific sequence differences when designing PCR primers, CRISPR guides, or antibody targets

Understanding these strain differences is essential for experimental design and interpretation, particularly in studies focused on lipid metabolism where Tecr plays crucial roles.

What experimental controls are essential when evaluating Tecr activity in cellular systems?

When evaluating Tecr activity in cellular systems, implementing proper controls is crucial for obtaining reliable and interpretable results. Based on established experimental design principles and specific considerations for Tecr research, the following controls should be incorporated:

  • Genetic controls:

    • Wild-type cells: Establish baseline Tecr activity in unmodified cells

    • Tecr knockout cells: Complete absence of Tecr activity (negative control)

    • Tecr overexpression cells: Amplified Tecr activity (positive control)

    • Rescue experiments: Reintroduction of Tecr in knockout cells to confirm specificity

  • Biochemical controls:

    • No enzyme control: Reaction mixture without cell lysate or purified enzyme

    • Heat-inactivated enzyme: Confirm that observed activity requires functional protein

    • Substrate specificity controls: Test multiple acyl-chain length substrates

    • Cofactor dependency: Reactions with and without NADPH to confirm requirement

  • Pharmacological controls:

    • Enzyme inhibitors: Use specific inhibitors of related enzymes to rule out their contribution

    • Pathway modulators: Compounds that affect upstream or downstream steps in fatty acid metabolism

  • Analytical controls:

    • Internal standards: Add known quantities of standards for quantification

    • Sample processing controls: Process standards alongside samples to account for losses

    • Matrix effects: Evaluate how complex cellular components affect measurements

  • Temporal and environmental controls:

    • Time course measurements: Establish linearity of enzyme activity

    • Temperature and pH conditions: Maintain consistent environmental conditions

    • Cell density and passage number: Standardize cellular conditions

Implementation table for experimental controls:

Control TypeImplementation MethodPurposeData Interpretation
GeneticCRISPR-Cas9 Tecr knockoutEstablish baseline without TecrActivity in WT minus activity in KO = Tecr-specific activity
BiochemicalNADPH omissionConfirm cofactor dependencyActivity with NADPH minus activity without = NADPH-dependent activity
PharmacologicalFatty acid synthesis inhibitorsRule out indirect effectsPersistent activity despite pathway inhibition confirms direct measurement
AnalyticalIsotope-labeled standardsEnsure accurate quantificationCorrection factor based on standard recovery
EnvironmentalTemperature variation (25°C vs. 37°C)Determine optimal conditionsEstablish temperature coefficient for activity normalization

Following experimental design principles in the biological sciences, these controls ensure that the observed changes in activity can be attributed specifically to Tecr function rather than to other variables or experimental artifacts .

How can CRISPR-Cas9 be optimized for generating Tecr knockout mouse models?

Generating precise Tecr knockout mouse models using CRISPR-Cas9 requires careful optimization at each stage of the process. Based on established experimental design principles for gene editing and considerations specific to the Tecr gene, the following methodological approach is recommended:

  • Guide RNA (gRNA) design:

    • Target early exons (preferably exons 1-3) of the Tecr gene to ensure complete functional disruption

    • Design multiple gRNAs (minimum 3-4) targeting different regions

    • Utilize algorithm-based tools to identify gRNAs with high on-target and low off-target scores

    • Avoid regions with known strain variations if working with non-C57BL/6J backgrounds

    • Test gRNA efficiency in mouse cell lines before in vivo application

  • Delivery method optimization:

    • For zygote injection (preferred method):

      • Optimize Cas9 concentration (typically 50-100 ng/μl)

      • Use purified Cas9 protein rather than mRNA for higher efficiency

      • Deliver gRNA at 25-50 ng/μl concentration

      • Consider using dual gRNAs to create larger deletions for guaranteed loss-of-function

    • For ESC-based method:

      • Select cell line matching desired mouse strain background

      • Optimize transfection conditions for high efficiency

      • Include selection marker for enrichment of edited cells

  • Screening and validation strategies:

    • Initial screening:

      • PCR amplification across target site followed by T7E1 assay or TIDE analysis

      • Direct sequencing of PCR products to identify indels

    • Functional validation:

      • RT-qPCR to confirm reduction/absence of Tecr mRNA

      • Western blot to verify absence of Tecr protein

      • Enzymatic activity assays to confirm loss of function

      • Lipidomic analysis to detect expected changes in VLCFA and sphingolipid profiles

  • Breeding strategy:

    • Backcross founder mice for at least 2-3 generations if off-target effects are a concern

    • Implement intercrossing of heterozygotes to generate homozygous knockouts

    • Maintain the line in heterozygous state if homozygous knockout is lethal or severely compromised

  • Phenotypic analysis specifics for Tecr:

    • Comprehensive lipidomic analysis of tissues with high Tecr expression

    • Neurological assessment (given Tecr's association with neurological conditions)

    • Membrane structure and function evaluation

    • Metabolic phenotyping focused on lipid homeostasis

By following this optimized protocol with specific considerations for Tecr, researchers can generate reliable knockout models to study the physiological roles of this enzyme in vivo, while ensuring experimental reproducibility across different laboratories .

What analytical techniques provide the most comprehensive characterization of lipid changes in Tecr-deficient models?

To comprehensively characterize lipid changes in Tecr-deficient models, a multi-platform analytical approach is essential due to the enzyme's dual role in VLCFA synthesis and sphingolipid metabolism. The following methodological framework integrates complementary techniques for comprehensive lipid analysis:

Primary Analytical Platforms

  • Mass Spectrometry-Based Lipidomics:

    • Untargeted lipidomics:

      • High-resolution LC-MS/MS for global lipid profiling

      • QTOF-MS for accurate mass determination of novel lipid species

      • Ion mobility-MS for separation of isomeric lipids

    • Targeted lipidomics:

      • Multiple reaction monitoring (MRM) for quantification of specific VLCFAs

      • Precursor ion and neutral loss scanning for sphingolipid classes

      • Stable isotope dilution for absolute quantification

  • Chromatographic Methods:

    • HPLC separation strategies:

      • Reverse-phase for fatty acid methyl esters (FAMEs) analysis

      • Normal phase for lipid class separation

      • HILIC for polar lipid species

    • GC-MS analysis:

      • Required for volatile fatty acid derivatives

      • Provides detailed fatty acid composition including positional isomers

Complementary Analytical Approaches

  • Structural Analysis Techniques:

    • NMR spectroscopy for structural confirmation of novel lipid species

    • Infrared spectroscopy for functional group characterization

    • UV-Vis spectroscopy for conjugated lipid systems

  • Functional Lipid Analysis:

    • Enzyme activity assays to measure residual Tecr activity

    • Pulse-chase labeling with stable isotopes to track metabolic flux

    • Lipid peroxidation assays to assess oxidative stress consequences

Data Integration and Analysis

  • Bioinformatic Analysis Pipeline:

    • Multivariate statistical analysis:

      • Principal component analysis (PCA)

      • Partial least squares discriminant analysis (PLS-DA)

      • ANOVA with appropriate post-hoc tests

    • Pathway mapping:

      • Integration with known lipid metabolic pathways

      • Network analysis of altered lipid species

Comparative Data Table for Analytical Methods:

Analytical MethodPrimary Target LipidsAdvantagesLimitationsKey Parameters
LC-MS/MSSphingolipids, phospholipids, neutral lipidsComprehensive coverage, high sensitivityComplex data analysisResolution >30,000, Mass accuracy <5ppm
GC-MSFatty acids (as FAMEs)Excellent separation of isomersLimited to volatile derivativesTemperature gradient 150-320°C
TLCAll lipid classesSimple, cost-effectiveLimited resolutionSolvent system optimization critical
Activity assaysN/A (enzyme function)Direct functional assessmentRequires tissue extractsNADPH consumption monitoring
Isotope labelingDynamic lipid metabolismMeasures flux rather than static levelsTechnically challengingEnrichment calculation methods

This integrated analytical approach ensures comprehensive characterization of the complex lipid changes resulting from Tecr deficiency, capturing both alterations in VLCFA synthesis and perturbations in sphingolipid metabolism .

How should contradictory data regarding Tecr's role in fatty acid elongation versus sphingolipid degradation be interpreted?

Interpreting contradictory data regarding Tecr's dual role in fatty acid elongation and sphingolipid degradation requires a systematic analytical approach. Based on the scientific literature, including the dual functions identified in the Trans-2-Enoyl-CoA Reductase TER study , the following methodological framework helps reconcile seemingly conflicting findings:

Contextual Analysis of Experimental Systems

When encountering contradictory data, first examine the experimental systems used:

System-dependent variation factors:

  • Cell/tissue type: Tecr may have tissue-specific predominant functions

  • Developmental stage: Relative importance of pathways may shift during development

  • Genetic background: Strain variations may affect enzyme function or pathway regulation

  • Metabolic state: Fasting/feeding or disease states may alter pathway utilization

Methodological Reconciliation Approach

Step 1: Map pathway-specific evidence

  • Categorize evidence supporting fatty acid elongation role

  • Categorize evidence supporting sphingolipid degradation role

  • Identify studies that address both pathways simultaneously

Step 2: Evaluate methodological differences

  • Substrate specificity in in vitro assays

  • Detection methods sensitivity and specificity

  • Knockout/knockdown approaches (acute vs. chronic)

  • Analytical techniques used for lipid profiling

Step 3: Consider adaptive compensatory mechanisms

  • Long-term Tecr deficiency may trigger alternative pathways

  • Upregulation of related enzymes may mask effects

  • Metabolic rewiring may occur in chronic models

Integrated Interpretation Framework

The dual function of Tecr should be viewed through an integrated lens:

  • Pathway connectivity: The S1P degradation pathway (where Tecr participates in sphingolipid metabolism) generates trans-2-hexadecenoyl-CoA, which must be converted to palmitoyl-CoA—this represents a point of convergence between pathways .

  • Substrate overlap: Tecr processes trans-2-enoyl-CoA intermediates regardless of their origin (either from de novo fatty acid synthesis or sphingolipid degradation).

  • Evolutionary perspective: The enzyme likely evolved to handle structurally similar substrates from different pathways, explaining its dual functionality.

  • Quantitative contribution: The relative contribution to each pathway may vary by context, explaining why some studies emphasize one function over the other.

Decision Matrix for Contradictory Data Resolution

Contradiction TypeAnalytical ApproachExample Resolution
Different substrate preferencesDirect kinetic comparison with purified enzymeDetermine Km and Vmax for each substrate to establish preference hierarchy
Opposing phenotypes in different modelsCross-platform validationReproduce findings in multiple systems and identify context-dependent factors
Temporal discrepanciesTime-course experimentsMap early vs. late effects to distinguish primary from secondary consequences
Concentration-dependent effectsDose-response studiesEstablish threshold concentrations for different pathway effects

By applying this systematic interpretive framework, researchers can reconcile apparently contradictory data and develop a more nuanced understanding of Tecr's integrated role in lipid metabolism, recognizing that dual functionality is not mutually exclusive but rather represents the biological complexity of metabolic enzymes .

What neurological phenotypes are associated with Tecr dysfunction and how can they be studied experimentally?

Tecr dysfunction has been associated with neurological phenotypes, including non-syndromic mental retardation as revealed by exome sequencing studies . This connection between a lipid metabolism enzyme and neurological function offers an important research area that requires specialized experimental approaches.

Neurological Phenotypes Associated with Tecr Dysfunction

  • Cognitive impairments:

    • Non-syndromic mental retardation in humans

    • Potential learning and memory deficits in model organisms

  • Neuroanatomical abnormalities:

    • Possible altered myelination due to VLCFA disruption

    • Potential changes in membrane composition affecting neuronal function

  • Electrophysiological alterations:

    • Modified synaptic transmission

    • Altered neuronal excitability

  • Behavioral manifestations:

    • Anxiety-related behaviors

    • Social interaction deficits

    • Motor coordination abnormalities

Genetic Models

Mouse Models:

  • Constitutive Tecr knockout: If viable, assess complete loss of function

  • Conditional Tecr knockout: Target specific neural populations or developmental stages

  • Point mutation models: Introduce mutations analogous to human pathogenic variants

  • Knockdown models: Use shRNA for partial reduction of Tecr expression

Cellular Models:

  • iPSC-derived neurons from affected individuals

  • CRISPR-edited neuronal cell lines

  • Primary neuronal cultures from Tecr-deficient models

Behavioral Assessment Battery

Behavioral DomainExperimental ParadigmMeasurement ParametersExpected Phenotype
Learning & MemoryMorris water mazeLatency to platform, search strategyImpaired spatial memory
Novel object recognitionDiscrimination indexReduced recognition memory
AnxietyElevated plus mazeTime in open armsAltered anxiety-like behavior
Social behaviorThree-chamber testInteraction timeSocial recognition deficits
Motor functionRotarodLatency to fallPotential coordination issues
Sensorimotor gatingPrepulse inhibitionStartle amplitudeDeficits in sensory processing

Neuroanatomical and Cellular Analyses

  • Structural neuroimaging:

    • MRI volumetric analysis of brain regions

    • Diffusion tensor imaging for white matter integrity

  • Histological analyses:

    • Myelin staining (Luxol fast blue)

    • Immunohistochemistry for neuronal and glial markers

    • Golgi staining for dendritic morphology

  • Ultrastructural studies:

    • Electron microscopy of synapses and myelin sheaths

    • Analysis of membrane structures

Electrophysiological Studies

  • In vitro electrophysiology:

    • Patch-clamp recordings of neuronal excitability

    • Field potential recordings in brain slices

  • In vivo recordings:

    • EEG patterns during sleep and wakefulness

    • Event-related potentials

Molecular and Biochemical Analyses

  • Lipidomic analysis of brain regions:

    • Regional sphingolipid and VLCFA profiling

    • Membrane lipid composition analysis

  • Transcriptomic profiling of affected brain regions

  • Synaptic protein expression and post-translational modifications

This comprehensive experimental framework allows researchers to connect Tecr's biochemical function in lipid metabolism to its role in neurological development and function, providing mechanistic insights into how disruptions in lipid homeostasis contribute to neurological phenotypes .

How can mouse strain-specific variations in Tecr be leveraged for structure-function studies?

The genetic diversity in Tecr across mouse strains provides a unique opportunity for structure-function studies without the need for artificial mutagenesis. Leveraging naturally occurring variations in Tecr among different mouse strains offers a powerful approach to understanding enzyme function and structure-activity relationships.

Comprehensive Variant Identification and Classification

First, catalog all Tecr variants across mouse strains using available genomic data:

Mouse Strain-Specific Tecr Variants Table:

Variation ClassificationExample StrainsPotential Functional ImpactStructural Domain
Conserved sequence (reference)C57BL/6J, C57BL/6NJBaseline activityN/A
Conservative substitutionsBALB/cJ, C3H/HeJMinimal impactVarious
Non-conservative substitutionsDBA/2J, A/JAltered substrate specificityCatalytic domain
Potential null/hypomorphic allelesSPRET/EiJSeverely reduced activityMultiple domains

Based on the comprehensive genomic analysis of 36 inbred strains, researchers can identify natural variants ranging from minimal changes to potentially significant alterations in Tecr function .

Experimental Design for Comparative Enzyme Studies

Step 1: Recombinant Protein Expression

  • Express and purify Tecr variants from different strains using identical expression systems

  • Ensure consistent purification methods to eliminate methodology-based differences

  • Verify protein folding and stability for each variant

Step 2: Biochemical Characterization

  • Determine enzyme kinetics (Km, Vmax, kcat) for each variant

  • Assess substrate specificity profiles across various chain-length substrates

  • Evaluate cofactor (NADPH) binding affinities

  • Test sensitivity to temperature, pH, and inhibitors

Step 3: Structural Correlation

  • Map variants to predicted structural domains

  • Generate homology models incorporating strain-specific variations

  • Identify critical residues for catalysis, substrate binding, and protein stability

Cellular Functional Analysis

Rescue Experiments Design:

  • Generate Tecr knockout cell lines (ideally from C57BL/6J background)

  • Transfect with expression vectors containing Tecr variants from different strains

  • Measure:

    • Complementation efficiency

    • Lipid profile restoration

    • Cellular phenotype rescue

Lipid Metabolism Assessment:

  • Compare VLCFA synthesis capacity

  • Evaluate sphingolipid metabolism

  • Assess membrane composition and properties

In Vivo Validation Strategy

For validating significant findings from in vitro studies:

  • Generate "strain-swap" knock-in mice where the C57BL/6J Tecr is replaced with variants from other strains

  • Perform comprehensive phenotyping including:

    • Lipidomic analysis of tissues

    • Metabolic parameters

    • Neurological assessment if relevant

Structure-Function Correlation Analysis

Integrate all data to create structure-function maps:

  • Identify residues/regions critical for specific functions

  • Determine which natural variants affect which aspects of enzyme function

  • Develop predictive models for how sequence changes influence activity

This methodological approach leverages natural genetic diversity to provide insights that would otherwise require extensive site-directed mutagenesis, with the advantage of studying variants that have been naturally selected and are viable in living organisms .

What are the key considerations for designing RNA interference experiments targeting Tecr?

Designing effective RNA interference (RNAi) experiments to target Tecr requires careful consideration of multiple factors to ensure specific knockdown while minimizing off-target effects. The following comprehensive methodology addresses critical aspects of RNAi experimental design for Tecr studies:

siRNA/shRNA Design Parameters

Target sequence selection:

  • Scan Tecr mRNA sequence for optimal target regions:

    • Avoid 5' and 3' UTRs

    • Target coding regions with 40-60% GC content

    • Avoid regions with known strain variations if working with multiple strains

    • Prioritize regions unique to Tecr to minimize off-target effects

Design criteria for effective knockdown:

  • 19-25 nucleotide target sequence

  • No internal repeats or palindromes

  • Low homology to other transcripts

  • Position 15-100 nucleotides downstream of start codon

  • Minimum of 3 siRNA/shRNA designs per target to account for variable efficacy

Control design:

  • Non-targeting scrambled sequence with similar GC content

  • Mismatch controls (3-4 nucleotide changes in the target sequence)

  • Positive control targeting a housekeeping gene

Delivery Method Optimization

For in vitro experiments:

Delivery MethodBest ForOptimization ParametersAdvantagesLimitations
Lipid transfectionPrimary cells, cell linesLipid:RNA ratio, cell densitySimple, cost-effectiveVariable efficiency
ElectroporationHard-to-transfect cellsVoltage, pulse durationHigh efficiencyPotential cell damage
Viral vectors (lentivirus)Stable knockdownMOI, selection markersLong-term expressionMore complex protocol

For in vivo applications:

  • Adeno-associated virus (AAV) delivery for tissue-specific knockdown

  • Nanoparticle formulations for systemic delivery

  • Consideration of tissue tropism for targeting specific organs

Validation Strategy

Knockdown verification:

  • qRT-PCR to measure Tecr mRNA levels (primary validation)

  • Western blot to confirm protein reduction

  • Enzyme activity assay to verify functional knockdown

Specificity controls:

  • Measure expression of closely related genes

  • Rescue experiments with RNAi-resistant Tecr cDNA

  • Use multiple independent siRNA sequences targeting different regions

Phenotype assessment:

  • Comprehensive lipidomic analysis to detect changes in:

    • Very long-chain fatty acids (VLCFAs)

    • Sphingolipid profiles

    • Membrane composition

  • Cell viability and morphology assessment

  • Functional assays relevant to Tecr's role in lipid metabolism

Experimental Design Considerations

Time course determination:

  • Pilot experiments to establish:

    • Optimal time for maximum knockdown (typically 48-72h for transient siRNA)

    • Duration of knockdown effect

    • Temporal changes in lipid profiles following knockdown

Dose optimization:

  • Titration experiments to determine:

    • Minimum effective concentration

    • Concentration that produces off-target effects

    • Optimal concentration for specific knockdown

Statistical design:

  • Minimum of 3-4 biological replicates

  • Technical replicates for each measurement

  • Appropriate statistical tests for data analysis

Documentation and Reporting

Critical parameters to record:

  • Complete sequence information of all siRNAs/shRNAs

  • Transfection conditions and efficiency

  • Cell type, passage number, and culture conditions

  • Quantitative knockdown efficiency at mRNA and protein levels

  • All experimental conditions following established reporting guidelines

This comprehensive approach ensures robust, reproducible RNAi experiments targeting Tecr that can provide reliable insights into the enzyme's function in lipid metabolism while minimizing experimental artifacts and off-target effects.

How can isotope labeling approaches be used to study Tecr-mediated metabolic pathways?

Isotope labeling represents a powerful approach to study Tecr-mediated metabolic pathways in both in vitro and in vivo systems. These techniques allow researchers to track the flow of specific atoms through metabolic networks, revealing the dynamics of Tecr's dual role in fatty acid elongation and sphingolipid metabolism.

Stable Isotope Selection Strategy

Primary isotopes for Tecr pathway analysis:

IsotopeApplicationAdvantagesMetabolic Tracing
¹³CFatty acid backbone labelingNon-radioactive, multiple positionsVLCFA elongation cycles
²H (deuterium)Reduction step trackingDistinguishes Tecr activityNADPH-dependent reduction
¹⁵NSphingolipid base labelingTracks sphingosine metabolismS1P degradation pathway
¹⁸OOxygen incorporationMonitors hydration/dehydrationIntermediate processing

Labeling pattern design:

In Vitro Experimental Approaches

Enzyme kinetics assessment:

  • Use ²H-labeled NADPH to directly measure Tecr reduction activity

  • ¹³C-labeled trans-2-enoyl-CoA substrates to track conversion to acyl-CoAs

  • Time-course analysis to determine reaction rates

Substrate flux studies:

  • Incubate cell lysates or microsomal fractions with labeled substrates

  • Measure incorporation into pathway intermediates and end products

  • Compare wild-type and Tecr-depleted systems

Coupled enzyme assays:

  • Reconstitute the fatty acid elongation complex with purified components

  • Use labeled substrates to track the progression through each step

  • Identify rate-limiting steps and potential regulatory points

Cellular Metabolic Flux Analysis

Pulse-chase experimental design:

  • Pulse phase: Incubate cells with labeled precursors (e.g., ¹³C-acetate)

  • Chase phase: Switch to unlabeled media

  • Sampling: Collect cells at multiple time points

  • Analysis: Track label incorporation and dilution over time

Comparative flux analysis in Tecr-manipulated cells:

  • Measure differences in labeling patterns between:

    • Control cells

    • Tecr-knockdown cells

    • Tecr-overexpressing cells

    • Tecr-inhibited cells

Pathway intersection mapping:

  • Use differentially labeled precursors for fatty acid synthesis and sphingolipid pathways

  • Identify convergence points where Tecr acts on substrates from different origins

In Vivo Metabolic Labeling

Administration routes and protocols:

  • Dietary incorporation of labeled fatty acids

  • Intravenous injection of labeled precursors

  • Continuous infusion for steady-state labeling

Tissue-specific analysis:

  • Harvest tissues with high Tecr expression

  • Separate subcellular fractions

  • Analyze label distribution in different lipid classes

Mouse model comparison:

  • Contrast labeling patterns in:

    • Wild-type mice

    • Tecr hypomorphic/knockout mice

    • Strain variants with altered Tecr activity

Analytical Platforms and Data Integration

Detection methods:

  • GC-MS/LC-MS: For labeled fatty acids and lipids

  • NMR spectroscopy: For positional isotope analysis

  • Isotope ratio MS: For precise isotope enrichment measurement

Data analysis approaches:

  • Isotopomer distribution analysis: Calculate relative pathway contributions

  • Flux balance analysis: Quantify metabolic reaction rates

  • Kinetic modeling: Determine rate constants for Tecr-catalyzed reactions

Integration with multi-omics data:

  • Correlate flux measurements with:

    • Transcriptomic changes

    • Protein expression levels

    • Global lipidomic profiles

This comprehensive isotope labeling methodology allows researchers to quantitatively assess Tecr's contribution to lipid metabolism, distinguish between its dual roles, and identify potential therapeutic targets for conditions associated with Tecr dysfunction .

What are the most effective purification strategies for obtaining high-yield, active recombinant mouse Tecr protein?

Purifying active recombinant mouse Trans-2,3-enoyl-CoA reductase (Tecr) presents several challenges due to its membrane-associated nature and the requirement to maintain enzymatic activity. The following methodological approach integrates proven strategies for obtaining high-yield, functionally active Tecr protein:

Expression System Selection and Optimization

E. coli expression system optimization:

  • Strain selection: BL21(DE3) derivatives with enhanced membrane protein expression capability

  • Vector design: pET series with N-terminal His-tag as demonstrated to be effective

  • Codon optimization: Adapt codons for E. coli preference while maintaining full-length sequence (1-308 amino acids)

  • Induction parameters:

    • Temperature: Lower to 16-18°C during induction

    • IPTG concentration: 0.1-0.5 mM

    • Duration: Extended induction (16-24 hours)

    • OD600 at induction: 0.6-0.8

Alternative expression systems:

  • Insect cell/baculovirus: Consider for higher eukaryotic post-translational modifications

  • Yeast expression: Pichia pastoris for secreted production

  • Mammalian cell expression: For native folding environment

Multi-Step Purification Strategy

Initial extraction optimization:

  • Membrane fraction isolation:

    • Gentle cell lysis via sonication or French press

    • Differential centrifugation to isolate membrane fractions

    • Detergent screening for optimal solubilization

Detergent selection matrix:

DetergentConcentration RangeAdvantagesLimitations
DDM0.5-1%Mild, maintains activityLarger micelles
LDAO0.5-2%Effective solubilizationPotentially destabilizing
Fos-Choline0.1-0.5%High solubilization efficiencyMay affect activity
Digitonin0.5-1%Very mild, activity-preservingExpensive, inconsistent

Chromatography sequence:

  • Immobilized metal affinity chromatography (IMAC):

    • Ni-NTA resin for His-tagged Tecr

    • Imidazole gradient elution (20-250 mM)

    • Include detergent in all buffers

  • Ion exchange chromatography:

    • Based on theoretical pI of mouse Tecr

    • Buffer optimization to maintain stability

  • Size exclusion chromatography:

    • Final polishing step

    • Assessment of oligomeric state

    • Buffer exchange to storage conditions

Activity Preservation Strategies

Stabilizing additives during purification:

  • Glycerol (6-10%): Prevents aggregation and stabilizes protein

  • Reducing agents: DTT (1-5 mM) or β-mercaptoethanol (5-10 mM)

  • Protease inhibitors: Complete cocktail to prevent degradation

  • Specific lipids: Consider adding phospholipids that mimic native environment

Storage optimization:

  • Flash-freeze in liquid nitrogen in small aliquots

  • Store lyophilized powder for long-term stability

  • For reconstitution, use Tris/PBS-based buffer with 6% trehalose at pH 8.0

  • Avoid repeated freeze-thaw cycles

Activity Verification Protocol

Enzymatic activity assays:

  • Spectrophotometric monitoring of NADPH oxidation at 340 nm

  • Direct product analysis by HPLC

  • Coupled enzyme assays for sensitive detection

Structural integrity assessment:

  • Circular dichroism to confirm secondary structure

  • Thermal shift assays to evaluate stability

  • Limited proteolysis to assess compact folding

Reconstitution for Functional Studies

Membrane mimetics for activity studies:

  • Liposome incorporation

  • Nanodiscs for defined lipid environment

  • Detergent micelles with optimized composition

Troubleshooting guide for low activity:

  • Adjust detergent concentration

  • Try different lipid compositions

  • Modify buffer conditions (pH, ionic strength)

  • Evaluate cofactor requirements

By implementing this comprehensive purification strategy, researchers can obtain high-yield, functionally active recombinant mouse Tecr protein suitable for enzymatic, structural, and drug discovery studies. The approach addresses the specific challenges associated with membrane-associated enzymes while preserving the catalytic activity essential for functional characterization .

How can computational modeling be integrated with experimental approaches to understand Tecr structure and function?

Integrating computational modeling with experimental approaches provides a powerful framework for understanding Tecr structure and function at multiple scales. This combined strategy overcomes the limitations of each individual approach and accelerates the discovery process.

Hierarchical Structural Modeling Strategy

Sequence-based analysis and prediction:

  • Multiple sequence alignment of Tecr across species

  • Identification of conserved functional domains

  • Prediction of transmembrane regions and topology

  • Detection of strain-specific variations with functional implications

Homology modeling workflow:

  • Template identification through structural database searches

  • Alignment refinement focusing on catalytic regions

  • Model building with special attention to membrane domains

  • Refinement through energy minimization

  • Validation using structural assessment tools

Advanced structural prediction:

  • Ab initio modeling for unique regions

  • Integration of cryo-EM or X-ray crystallography data when available

  • Incorporation of experimental constraints from mutagenesis studies

Molecular Dynamics Simulations

System preparation for simulation:

  • Embedding Tecr models in appropriate membrane environments

  • Addition of explicit solvent and physiological ions

  • Incorporation of cofactors (NADPH) and substrate molecules

Simulation protocols:

  • Equilibration under physiological conditions

  • Production runs at microsecond timescales

  • Enhanced sampling techniques for substrate binding and product release

Analysis focus areas:

  • Conformational dynamics during catalytic cycle

  • Substrate access channels and binding pocket properties

  • Effects of strain-specific variations on protein dynamics

  • Cofactor interactions and binding energy calculations

Systems Biology Integration

Pathway modeling approach:

  • Stoichiometric models of fatty acid elongation

  • Kinetic modeling of sphingolipid metabolism

  • Integration of Tecr-specific parameters from experiments

  • Sensitivity analysis to identify critical control points

Multi-scale modeling framework:

  • Connect molecular events to cellular lipid homeostasis

  • Predict systemic effects of Tecr perturbations

  • Model compensatory mechanisms in Tecr deficiency

Network analysis:

  • Map Tecr interactions within lipid metabolism networks

  • Identify potential crosstalk with other pathways

  • Predict emergent properties from pathway integration

Experimental Validation Pipeline

Structure-guided mutagenesis:

  • Design mutations based on computational predictions

  • Focus on predicted catalytic residues, substrate binding sites

  • Create mutations mimicking strain variations

Binding studies validation:

  • In silico docking of substrates and inhibitors

  • Experimental validation through binding assays

  • Iterative refinement of computational models

Activity correlation analysis:

  • Measure activity of wild-type and mutant variants

  • Correlate with computational predictions

  • Refine models based on experimental feedback

Applications in Drug Discovery and Disease Modeling

Virtual screening workflow:

  • Develop pharmacophore models based on substrate binding

  • Screen compound libraries against Tecr models

  • Prioritize candidates for experimental testing

Disease-associated mutation analysis:

  • Model effects of mutations linked to neurological conditions

  • Predict functional consequences and severity

  • Design compensatory strategies

Therapeutic strategy development:

  • Identify allosteric modulation sites

  • Design targeted interventions for Tecr dysfunction

  • Model potential off-target effects

Integration Framework Diagram:

The integration of computational and experimental approaches follows this cyclical workflow:

  • Initial structural prediction → Experimental validation

  • Refined models → Structure-guided experiments

  • Functional insights → Systems-level modeling

  • Network predictions → Targeted interventions

  • Observed outcomes → Model refinement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.