Recombinant Mouse Translocase of inner mitochondrial membrane domain-containing protein 1 (Timmdc1)

Shipped with Ice Packs
In Stock

Description

Key Functional Domains:

DomainFunction
Transmembrane helicesAnchoring to the inner mitochondrial membrane
Matrix extensionsInteraction with Complex I subunits and assembly factors

Table 1: Recombinant Timmdc1 Products

SourceExpression SystemTagCatalog NumberApplication
Creative BioMart E. coliHisRFL18126MFStructural/biochemical studies
R&D Systems MammalianHis1817-TMBioassays, ELISA
Abbexa N/AN/AN/AELISA detection

Recombinant Timmdc1 is utilized in:

  • Complex I assembly studies: To probe interactions with assembly factors (e.g., NDUFAF1, ECSIT) .

  • Disease modeling: For studying mitochondrial Complex I deficiencies linked to TIMMDC1 mutations .

  • Therapeutic development: Testing antisense oligonucleotides (SSOs) to correct splicing defects .

Mitochondrial Complex I Deficiency

A deep intronic TIMMDC1 variant (c.597-1340A>G) disrupts splicing, leading to a frameshift and loss of functional protein. This causes:

  • Neurological phenotypes: Failure to thrive, hypotonia, drug-resistant epilepsy, and infantile death .

  • Mitochondrial dysfunction: Reduced Complex I activity and ATP production .

Table 2: Clinical and Experimental Outcomes of TIMMDC1 Deficiency

ParameterEffectReference
TIMMDC1 protein levelsUndetectable in patient cells
Complex I activitySeverely impaired
SSO treatment outcomeRestored mRNA splicing and protein levels

Cancer Metastasis

High TIMMDC1 expression correlates with metastatic potential in gastric cancer. Knockdown experiments revealed:

  • Reduced cell proliferation: In vitro and in vivo tumor growth inhibition .

  • Altered signaling: Downregulation of AKT/GSK3β/β-catenin pathways .

Splice-Switching Antisense Oligonucleotides (SSOs)

SSOs targeting the aberrant splice site in TIMMDC1 have shown promise in preclinical models:

  • Mechanism: Block cryptic exon inclusion, restoring normal mRNA splicing .

  • Efficacy:
    -Complete disappearance of aberrant transcripts .
    -Recovery of Complex I subunit abundance and mitochondrial respiration .

Detection and Quantification Tools

Recombinant Timmdc1 is analyzed using:

  • ELISA kits: Quantitative measurement in tissue lysates (Abbexa, test range: 0.156–10 ng/mL) .

  • Western blotting: Detection via His-tag antibodies (R&D Systems) .

Pathway Involvement

Timmdc1 interacts with components of the MCIA complex (ECSIT-TMEM126B-ACAD9-NDUFAF1) and is critical for:

PathwayRoleAssociated Proteins
Respiratory electron transportComplex I assemblyNDUFAF1, ECSIT, TMEM126B
MetabolismATP synthesis, heat productionUCP2, SCO1, COX18

Future Directions

  • Gene therapy: Developing SSO-based therapies for TIMMDC1-related disorders .

  • Cancer research: Investigating TIMMDC1 as a therapeutic target in metastatic cancers .

  • Structural studies: Elucidating Timmdc1’s topology and interactions with Complex I subunits .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Timmdc1; Complex I assembly factor TIMMDC1, mitochondrial; Translocase of inner mitochondrial membrane domain-containing protein 1; TIMM domain containing-protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Timmdc1
Target Protein Sequence
MGAPPPAPRSRLCGAWGPFPRVFAAGAVAADSPGFVEDREQRSGVSDPGSLESGWDRLRQ LFAKDEQQRFSKEIDYIYRAAVSAGIIGWAYGGIPAFIYAKKRYIEQSQAEIYHNRFDAV QSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDAMSHFAIAGAVTGGLFR INLGVRGLVAGSIIGALLGAPMGSLLMALEKYSGETVQERRQKEWKALHEQRLEEWRSSL QVTELLPMEIESGLEKIQPEGDAQRIEELLSLPRNPSSPHQQSKH
Uniprot No.

Target Background

Function
Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (Complex I). It plays a role in constructing the membrane arm of Complex I.
Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is TIMMDC1 and what is its primary function in mitochondria?

TIMMDC1 (Translocase of Inner Mitochondrial Membrane Domain-Containing protein 1) functions as a critical subunit of complex I of the electron transport chain responsible for ATP production. Located in the mitochondrial inner membrane, it plays an essential role in energy metabolism by facilitating the assembly and stability of complex I .

In mouse models, TIMMDC1 demonstrates high conservation with the human ortholog and serves as an integral component of the IP (NDUFS2/NDUFS3/NDUFS7/NDUFS8) subcomplex during complex I biogenesis. The protein contains transmembrane domains that anchor it to the inner mitochondrial membrane, where it participates in the coordinated assembly of both membrane and matrix arms of complex I .

What experimental models are most suitable for studying mouse TIMMDC1 function?

Several experimental models are appropriate for investigating mouse TIMMDC1 function:

  • Mouse embryonic fibroblasts (MEFs): Particularly useful for studying the basic cellular functions of TIMMDC1 in a native environment with preserved signaling pathways.

  • CRISPR/Cas9-generated knockout/knockin mouse models: Allow for whole-organism evaluation of TIMMDC1 function and the physiological consequences of its deficiency.

  • Patient-derived fibroblasts (for comparative studies): Though not mouse-specific, these can be valuable when comparing human and mouse TIMMDC1 function in parallel experiments .

  • Neuronal cell cultures: Since TIMMDC1 deficiency has been associated with neurological disorders, primary neuronal cultures from transgenic mice can provide insights into tissue-specific effects .

When selecting a model, researchers should consider that complete TIMMDC1 knockout may be embryonically lethal due to its critical role in energy metabolism, making conditional or inducible systems preferable for long-term studies.

How can recombinant mouse TIMMDC1 be effectively expressed and purified?

Expression System Selection:
The optimal expression system for recombinant mouse TIMMDC1 requires careful consideration due to its transmembrane domains and mitochondrial localization.

Recommended Protocol:

  • Vector Construction:

    • Clone the mouse Timmdc1 gene (without mitochondrial targeting sequence for cytosolic expression) into a vector with appropriate tags (His6, FLAG, or GST)

    • Include TEV protease cleavage sites if tag removal is desired

  • Expression Systems Comparison:

Expression SystemAdvantagesLimitationsYield
E. coliLow cost, rapid growthLack of post-translational modifications, inclusion body formationLow-Moderate
Insect cellsBetter folding of mammalian proteinsMore complex system, longer production timeModerate-High
Mammalian cellsNative post-translational modificationsHighest cost, longest production timeModerate
  • Purification Strategy:

    • Membrane solubilization using mild detergents (DDM or LMNG)

    • IMAC for His-tagged constructs

    • Size exclusion chromatography for final purity

  • Quality Control:

    • Western blot analysis

    • Mass spectrometry

    • Functional assays (ATP production measurement)

The choice of expression system should be guided by the intended application of the recombinant protein, with mammalian systems preferred for structural studies and E. coli sufficient for antibody production.

What antibodies are recommended for mouse TIMMDC1 detection in various experimental applications?

When selecting antibodies for mouse TIMMDC1 detection, researchers should consider the specific application and required sensitivity:

Western Blotting:

  • Polyclonal antibodies raised against multiple epitopes offer better detection sensitivity

  • Look for antibodies validated specifically in mouse tissue lysates

  • Expected molecular weight: approximately 31 kDa

Immunohistochemistry/Immunofluorescence:

  • Monoclonal antibodies typically provide higher specificity for localization studies

  • Confirm antibodies are validated for fixed tissue applications

Immunoprecipitation:

  • Antibodies with high affinity for native conformation are essential

  • Magnetic bead-conjugated antibodies often yield better results than agarose-based systems

Always validate antibodies in your specific experimental system, as cross-reactivity with other mitochondrial proteins can occur. Include appropriate positive controls (mouse heart or liver tissue, which express high levels of TIMMDC1) and negative controls (TIMMDC1 knockout samples if available).

How do TIMMDC1 mutations affect mitochondrial function and what models best recapitulate these defects?

TIMMDC1 mutations significantly impact mitochondrial function through disruption of complex I assembly and activity. In human patients, pathogenic variants in TIMMDC1 (such as the intronic c.597-1340A>G variant) lead to severe neurodegenerative phenotypes characterized by failure to thrive, hypotonia, peripheral neuropathy, and drug-resistant epilepsy .

Cellular Consequences of TIMMDC1 Deficiency:

  • Complex I Assembly Defects:

    • Reduced abundance of complex I subunits

    • Accumulation of assembly intermediates

    • Compromised stability of the NADH dehydrogenase module

  • Bioenergetic Dysfunction:

    • Decreased oxygen consumption rate

    • Reduced ATP production

    • Elevated ROS production

  • Compensatory Responses:

    • Upregulation of other respiratory complexes

    • Metabolic shifting toward glycolysis

    • Mitochondrial network remodeling

Optimal Mouse Models:

Model TypeStrengthsLimitationsPhenotypic Recapitulation
Constitutive KOComplete protein lossEarly lethality limits studySevere but short-lived
Conditional KOTissue-specific analysisRequires careful temporal controlModerate to severe
Knockin (patient mutations)Most physiologically relevantComplex to generateHighly accurate
siRNA/shRNARapid implementationIncomplete knockdownMild to moderate

For studying therapeutic approaches, mouse models carrying equivalent human pathogenic variants (such as the c.597-1340A>G intronic variant) provide the most relevant system for testing interventions like splice-switching antisense oligonucleotides (SSOs) .

What experimental approaches are most effective for studying TIMMDC1 interactions with other complex I assembly factors?

Understanding TIMMDC1's interactions with other complex I assembly factors requires a multi-faceted experimental approach:

Proximity-Based Protein Interaction Mapping:

  • BioID or APEX2 Proximity Labeling:

    • Fusion of TIMMDC1 with a biotin ligase (BirA*) or APEX2

    • Enables identification of transient and stable interactors in the native mitochondrial environment

    • Superior to traditional pull-downs for membrane protein complexes

  • Crosslinking Mass Spectrometry (XL-MS):

    • Captures direct protein-protein interactions through covalent crosslinking

    • Provides spatial constraints for structural modeling

    • Can identify interaction interfaces

  • Co-Immunoprecipitation with Sequential Protein Extraction:

    • Differential detergent extraction to distinguish membrane-dependent interactions

    • Coupled with quantitative proteomics for interaction strength estimation

Interaction Validation and Characterization:

Based on Reactome pathway data, TIMMDC1 interacts with multiple assembly factors during complex I biogenesis, particularly during the formation of Intermediate 1 where it associates with NDUFAF3 and NDUFAF4 .

Interaction PartnerDetection MethodBiological SignificanceValidation Approach
NDUFAF3Co-IP, BioIDEarly assembly intermediate formationReciprocal pull-downs, FRET
NDUFAF4Co-IP, BioIDEarly assembly intermediate formationMutagenesis of interaction sites
ND1 (mtDNA-encoded)XL-MSMembrane arm assemblyPulse-chase with translation inhibitors
NDUFS2/NDUFS3Co-IP, PLAIP subcomplex integrationIn vitro reconstitution

For comprehensive interaction mapping, combine these approaches with super-resolution microscopy to visualize the spatiotemporal dynamics of complex I assembly intermediates containing TIMMDC1.

How can antisense oligonucleotides be designed to modulate mouse TIMMDC1 expression for therapeutic applications?

Antisense oligonucleotides (SSOs) represent a promising therapeutic approach for TIMMDC1-related disorders, as demonstrated in human patient-derived cells . For mouse models, the design principles remain similar but require mouse-specific sequence considerations:

SSO Design Principles for Mouse TIMMDC1:

  • Target Selection:

    • Identify mouse-specific splice regulatory elements

    • Focus on evolutionary conserved intronic regions when targeting equivalent human mutations

    • Prioritize regions with accessible secondary structure

  • Chemistry Optimization:

ChemistryAdvantagesLimitationsBlood-Brain Barrier Penetration
MorpholinoLow toxicity, high stabilityCharge-neutral, delivery challengesLimited without conjugation
2'-O-methoxyethyl (MOE)Good stability, well-characterizedPotential hepatotoxicityModerate
Phosphorodiamidate morpholino oligomer (PMO)Low toxicity, long in vivo half-lifeCharge-neutral, delivery challengesLimited without conjugation
Locked nucleic acid (LNA)High target affinity, small effective dosePotential hepatotoxicityGood
  • Delivery Systems for CNS Targeting:

    • Direct intracerebroventricular injection

    • BBB-penetrating peptide conjugation

    • Nanoparticle encapsulation

In a study with human patient cells carrying the c.597-1340A>G TIMMDC1 variant, two different SSOs were designed to restore normal TIMMDC1 mRNA processing and protein levels. Similar approaches in mouse models would require:

  • Careful mapping of the mouse Timmdc1 intronic regions

  • Identification of mouse-specific splicing regulatory elements

  • Screening multiple SSO candidates in mouse cell culture before in vivo application

  • Quantitative assessment of complex I restoration using proteomic and functional assays

This therapeutic approach has particular relevance for genetic variants affecting splicing, which represent a significant portion of pathogenic TIMMDC1 mutations.

What proteomics approaches best assess the impact of TIMMDC1 deficiency on mitochondrial complex I assembly?

Comprehensive assessment of TIMMDC1 deficiency effects on complex I assembly requires sophisticated proteomics methodologies that can capture both compositional and structural changes:

Quantitative Mitochondrial Proteomics Workflow:

  • Sample Preparation Options:

    • Highly purified mitochondria from control and TIMMDC1-deficient samples

    • Blue Native PAGE fractionation to separate intact complexes

    • Sucrose gradient ultracentrifugation for assembly intermediate isolation

  • Quantification Strategies:

MethodAdvantagesData OutputApplication
SILACAccurate quantification, early mixing of samplesRelative protein abundanceCell culture models
TMT/iTRAQMultiplexing capability, sample comparisonRelative protein abundanceMultiple condition comparison
Label-freeNo labeling required, unlimited samplesRelative protein abundanceTissue samples
Absolute quantificationTrue protein quantity determinationAbsolute protein amountsStoichiometry analysis
  • Complex I Assembly-Specific Approaches:

    • Complexome profiling (combines BN-PAGE with mass spectrometry)

    • Pulse-SILAC to monitor assembly kinetics

    • Crosslinking mass spectrometry for structural changes

Data from human patient fibroblasts with TIMMDC1 deficiency showed that quantitative proteomics coupled with real-time metabolic analysis can effectively demonstrate restoration of complex I subunit abundance and function following therapeutic intervention . Similar approaches in mouse models can provide mechanistic insights into assembly defects and identify potential compensatory mechanisms.

The most informative approach combines multiple techniques, including complexome profiling to identify stalled assembly intermediates alongside functional respiratory chain measurements to correlate proteome changes with bioenergetic consequences.

What are the challenges in developing therapeutic strategies for TIMMDC1-related disorders based on mouse model findings?

Developing effective therapeutics for TIMMDC1-related disorders presents several significant challenges that must be addressed when translating findings from mouse models to human applications:

Translational Challenges from Mouse to Human:

  • Genetic and Phenotypic Differences:

    • Mouse Timmdc1 has subtle sequence divergence from human TIMMDC1

    • Phenotypic severity may differ between species

    • Cell-type specific vulnerabilities may not be fully conserved

  • Mitochondrial Complex I Composition Differences:

FeatureMouseHumanImplication
Complex I size45 subunits45 subunitsBroadly similar architecture
Tissue distributionHighest in heart, brainHighest in heart, brainSimilar tissue vulnerability
Assembly factorsLargely conservedLargely conservedSimilar assembly pathway
Response to deficiencyCompensatory glycolysisCompensatory glycolysisSimilar metabolic adaptation
  • Therapeutic Delivery Challenges:

    • Blood-brain barrier penetration limitations

    • Achieving therapeutic concentrations in affected tissues

    • Potential immune responses to recombinant proteins

    • Differences in drug metabolism between species

A promising therapeutic approach demonstrated in human patient fibroblasts involves splice-switching antisense oligonucleotides (SSOs) designed to restore normal TIMMDC1 mRNA processing and protein levels. This approach successfully restored complex I subunit abundance and function in cellular models .

For successful translation of this approach:

  • Mouse-specific SSO sequences would need to be adapted for human application

  • Delivery methods optimized in mice would require adjustment for human physiology

  • Dosing regimens established in mice would need clinical recalibration

  • Long-term safety profiles would require extensive assessment beyond typical mouse lifespan

The rare nature of TIMMDC1-related disorders (with variants like c.597-1340A>G present at approximately 1/5000 frequency in human populations) also complicates clinical trial design and necessitates careful patient selection strategies to demonstrate therapeutic efficacy.

What are the most promising research directions for TIMMDC1 studies?

The investigation of TIMMDC1 represents an important frontier in mitochondrial medicine, with several promising research directions:

  • Structure-Function Relationships: Determining the precise structural role of TIMMDC1 in complex I assembly using cryo-EM and advanced structural biology approaches.

  • Tissue-Specific Functions: Exploring the differential requirements for TIMMDC1 across tissues, particularly in high-energy demanding cells like neurons and cardiomyocytes.

  • Therapeutic Development: Expanding antisense oligonucleotide approaches to target various TIMMDC1 mutations, potentially offering personalized medicine solutions for patients with mitochondrial disorders .

  • Compensatory Mechanisms: Identifying cellular pathways that can compensate for TIMMDC1 deficiency, potentially revealing new therapeutic targets.

  • Biomarker Discovery: Developing reliable biomarkers for TIMMDC1 dysfunction that could be used for diagnosis and monitoring treatment efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.