Recombinant Mouse Translocation protein SEC62 (Sec62)

Shipped with Ice Packs
In Stock

Description

General Information

The SEC62 gene, also known as TLOC1, is located on chromosome 3q26 . The mammalian Sec62 protein resides in the ER membrane and contains two transmembrane helices, a short ER-lumenal loop, and two large cytosolic domains . Sec62 forms a heterodimeric complex with the Sec63 protein and transiently associates with the heterotrimeric Sec61 complex . These interactions involve a positively charged patch of amino acid residues in the N-terminal domain of Sec62 plus a negatively charged cluster at the C-terminus of Sec63 and the C-terminal domain of Sec62 (including two predicted EF hands) plus the N-terminus of Sec61α, respectively .

Function

Sec62 is involved in the translocation and membrane insertion of proteins with diverse sequence contexts, including variations in hydrophobicity, the number of transmembrane segments, flanking charged residues, and different membrane orientations . Sec62 is necessary in the SRP-independent translocation pathway . Sec62 facilitates the translocation of the C-terminus of membrane proteins and plays a role in the topogenesis of membrane proteins in the ER .

Sec62 is crucial for the efficient translocation of small proteins with N-terminal signal sequences . Specifically, proteins shorter than 160 amino acids rely on Sec62 for maximal translocation efficiency, whereas longer proteins depend on the signal recognition particle (SRP) . This suggests that the Sec62 pathway acts as a fail-safe route for small preproteins, ensuring their efficient secretion regardless of the SRP pathway .

SEC62 in Disease

Elevated Sec62 protein levels have been found in tumor tissue compared to tumor-free tissue in 53 breast cancer patients .

SEC62 copy number gains have been identified in prostate cancer samples, along with elevated Sec62 protein levels in prostate cancer cell lines . Overexpression of SEC62 is associated with prostate cancer progression, increasing ER stress tolerance and promoting migratory and invasive potential in prostate cancer cells . Sec62 has been proposed as a potential diagnostic marker and therapeutic target in prostate cancer . Similar observations have been made for non-small cell lung cancer (NSCLC) and thyroid cancer .

Sec62 Mutant Strains

Systematic mutagenesis of Sec62 has been performed to assess its role in translocation and membrane insertion . Mutations in the N-terminal cytosolic domain of Sec62 disrupt its interaction with Sec63, leading to defects in the translocation of moderately hydrophobic transmembrane segments in both single- and multi-spanning membrane proteins . Studies using mutant strains have demonstrated that a defective Sec62-Sec63 complex impairs the membrane insertion of moderately hydrophobic transmembrane domains, as well as transmembrane domains with charged flanking residues .

5.1. Effects of Sec62 Mutations on Translocation and Membrane Insertion

Model ProteinMutationEffect
H2-2L35DDD/103DDDMore than twofold reduction in membrane insertion and translocation of the C-terminus
H2-3L35DDD/103DDDSmall reduction in membrane insertion and translocation of the C-terminus (27% and 23%, respectively)
H2-K1LG35DDDSignificant defect in membrane insertion and translocation of the C-terminus, with double glycosylation reduced from 54% in wild-type cells to 16%
H3-4L35DDD/103DDDReduction in the C out membrane orientation compared to the C in orientation, with a 28% and 24% decrease in the 3G form (membrane-inserted) in mutant strains, respectively
H3-5L35DDD/103DDDReduction in the C out membrane orientation compared to the C in orientation, with a 22% and 13% decrease in the 3G form (membrane-inserted) in mutant strains, respectively

5.2. Sec62 Interactions and Function

Interaction PartnerDomain(s) InvolvedFunction
Sec63Positively charged patch in the N-terminal domain of Sec62 and a negatively charged cluster at the C-terminus of Sec63 Forms a heterodimeric complex; crucial for translocation and membrane insertion, particularly for moderately hydrophobic transmembrane segments
Sec61C-terminal domain of Sec62 (including two predicted EF hands) and the N-terminus of Sec61α Transiently associates with the heterotrimeric Sec61 complex; Sec61 channel can act as a passive ER calcium leak channel
SRPNot directly interacting, but Sec62-dependent translocation is crucial for small proteins when the SRP pathway is inefficient Sec62-dependent translocation guarantees efficient secretion of small preproteins independent of the SRP pathway; proteins shorter than 160 amino acids rely on Sec62, while longer proteins depend on SRP

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sec62; Tloc1; Translocation protein SEC62; Translocation protein 1; TP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-398
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVECLLDSK WAKAKKGEDALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDVKKEKDKGKSESGKE DDKKSKKESVKEEKTKKEKEKKKDGEKEDSKKEETPGTPKKKETKKKFKLEPHDDQVFLD GNEVFVWIYDPVHIKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAIARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE TKKQQKSDSEEKSDSEKKEDEEGKGAPADHGPEGSGGERHSDTDSDRREDDRSQHSSGNG NDFEMITKEELEQQTDGDCDEEDDDKDGEVPKSAHEKS
Uniprot No.

Target Background

Function
Recombinant Mouse Translocation protein SEC62 (Sec62) mediates the post-translational transport of precursor polypeptides across the endoplasmic reticulum (ER). It is proposed to function as a targeting receptor for small presecretory proteins containing short, apolar signal peptides. Sec62 targets and positions newly synthesized presecretory proteins within the SEC61 translocon channel complex, triggering channel opening for polypeptide translocation into the ER lumen.
Gene References Into Functions
  1. Sec62 is a critical component in maintaining and recovering endoplasmic reticulum homeostasis. PMID: 27749824
  2. Ribosome and Sec62 interactions with the core Sec61 translocon are mutually exclusive. PMID: 26634806
  3. Sec62 plays a role in the post-translational transport of presecretory proteins into the endoplasmic reticulum. PMID: 22375059
Database Links
Protein Families
SEC62 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEC62 and what is its fundamental role in cellular physiology?

SEC62 is a component of the Sec62-Sec63 complex that primarily functions as a mediator of post-translational translocation of proteins into the endoplasmic reticulum (ER). It was traditionally thought to handle mainly secretory proteins rather than membrane proteins . The protein contains transmembrane domains that anchor it in the ER membrane, with a cytosolic N-terminal domain that interacts with other components of the translocation machinery, particularly SEC63 . This interaction is critical for the proper functioning of the complex in protein translocation events.

How is SEC62 structurally organized?

SEC62 contains multiple domains that contribute to its function in protein translocation:

  • N-terminal cytosolic domain: Critical for interaction with SEC63 and proper translocation function

  • Transmembrane domains: Anchor the protein in the ER membrane

  • C-terminal domain: Contains functional elements involved in substrate recognition

Mutations in the N-terminal cytosolic domain can impair SEC62's interaction with SEC63, leading to defects in membrane insertion and translocation of the C-terminus of membrane proteins . This structural organization is essential for understanding how SEC62 contributes to protein translocation and membrane protein topogenesis.

What is the difference between SEC62's function in yeast versus mammalian cells?

While SEC62's basic function in post-translational translocation is conserved across species, there are notable differences in its role between yeast and mammalian systems:

ParameterYeast SEC62Mammalian SEC62
Primary pathwayPost-translational onlyPost-translational and membrane protein insertion
Substrate specificityPrimarily secretory proteinsBroader range including membrane proteins
Associated complexesStrictly with SEC63More diverse interactions
RegulationLess complexInvolved in ER stress responses and homeostasis

Recent research has uncovered that, contrary to previous assumptions, SEC62 in yeast plays an important role in membrane protein insertion and the regulation of membrane protein topogenesis . This represents a significant expansion of our understanding of SEC62 function beyond its classical role.

How does SEC62 contribute to endoplasmic reticulum homeostasis?

SEC62 has a newly discovered role in regulating ER turnover during recovery from stress. This function is particularly enhanced after the successful resolution of ER stress and contributes to re-establishing pre-stress ER homeostasis . The protein appears to participate in a process that helps clear ER components through autophagy after stress resolution, a process sometimes referred to as "recovER-phagy."

What is the role of SEC62 in membrane protein topogenesis?

While SEC62 was traditionally associated exclusively with post-translational translocation of secretory proteins, systematic analysis has revealed its unexpected role in membrane protein insertion and topogenesis . Specifically:

  • SEC62 contributes to the proper membrane insertion of both single and multi-spanning membrane proteins

  • It helps regulate the orientation of transmembrane segments with varying properties (hydrophobicity, flanking charged residues)

  • Mutations in SEC62, particularly in its N-terminal domain, can lead to defects in membrane insertion and C-terminal translocation of membrane proteins

This represents a paradigm shift in our understanding of SEC62 function, as it indicates that the Sec62-Sec63 translocon has a broader role in eukaryotic cells than previously thought.

How does SEC62 influence cell proliferation and migration?

Studies using SEC62 knockout cell lines have demonstrated that SEC62 significantly impacts cell proliferation and migration:

  • SEC62 knockout in head and neck squamous cell carcinoma (HNSCC) cell lines results in markedly reduced proliferation rates compared to wild-type cells

  • Migration potential is substantially decreased in SEC62 knockout cells

  • The migratory and proliferative effects appear to be directly related to SEC62 function rather than secondary consequences

These findings suggest that SEC62 may represent a potential therapeutic target in cancers where cell migration and proliferation are key drivers of disease progression. The exact molecular mechanisms connecting SEC62's translocation function to these cellular processes remain an active area of investigation.

How can researchers generate and validate SEC62 knockout models?

Creating effective SEC62 knockout models requires careful consideration of methodological approaches. Based on published research, the following protocol has proven effective:

  • CRISPR/Cas9 approach:

    • Design gRNA targeting SEC62 (e.g., sequence 5'-CTG TGG TTG ACT ACT GCA AC-3')

    • Transfect cells with lentiCRISPRv2-puro system containing the gRNA

    • Select transfected cells using puromycin (1.5 μg/ml)

    • Culture cells for approximately 5 days under selection pressure

    • Separate cells in low numbers (1000-2000 cells) for single cell isolation

    • Allow colonies to form (approximately 12 weeks)

    • Harvest colonies and conduct a second single cell clone selection step

    • Culture selected cells for an additional 8 weeks until monoclonal colonies form

  • Validation approaches:

    • Next-generation sequencing (NGS) to confirm genetic modifications

    • Western blotting to verify protein depletion

    • Functional assays to confirm loss of SEC62-dependent activities

In published studies, successful SEC62 knockout has been validated by NGS showing that 88-92% of sequencing reads differed from the reference genome, with most containing insertions or deletions near the PAM sequence . At the protein level, western blot analysis showed nearly undetectable SEC62 (3-4% of wild-type levels) .

What functional assays can be used to assess SEC62-dependent processes?

Several well-established assays can be employed to evaluate SEC62 function:

AssayPurposeMethodologyReference
Proliferation assayMeasure cell growth ratexCELLigence system measuring cell index over time (35-60h for exponential phase)
Migration assayAssess cell motilityFluoroBlok system with DAPI staining of migrated cells
Protein translocation assayEvaluate ER translocation efficiencyIn vitro translocation of reporter proteins (e.g., ERj3)
ER-autophagy assessmentMeasure ER turnoverVisualization of ER markers in Lamp1-positive vesicles after stress
Isopycnic gradient separationSeparate autophagic vesicles from ERDensity gradient centrifugation followed by western blot or MS-LFQ analysis

These assays provide complementary information about SEC62 function in different cellular contexts. For example, the translocation assay directly measures SEC62's classical function, while the proliferation and migration assays capture its broader physiological roles .

How should experiments be designed to investigate SEC62's role in ER stress recovery?

To properly investigate SEC62's function in ER stress recovery, researchers should consider the following experimental design principles:

  • Stress induction and recovery protocol:

    • Apply appropriate ER stressors (e.g., tunicamycin, thapsigargin) at effective concentrations

    • Allow sufficient time for stress adaptation (typically 16-24 hours)

    • Remove stressor and allow recovery phase (4-24 hours)

    • Analyze SEC62-dependent processes during the recovery phase specifically

  • Key controls and comparisons:

    • SEC62 wild-type cells

    • SEC62 knockout cells

    • SEC62 knockout cells with reintroduced wild-type SEC62

    • SEC62 knockout cells with reintroduced mutant SEC62 (e.g., SEC62LIRmut)

  • Critical measurements:

    • Accumulation of ER markers in Lamp1-positive vesicles

    • Use of lysosomal inhibitors (e.g., Bafilomycin A1) to prevent degradation and enhance visualization

    • Protein translocation efficiency before, during, and after stress

    • ER morphology and turnover rates

Published research demonstrates that SEC62 is particularly important during the recovery phase, as evidenced by the accumulation of ER marker proteins in Lamp1-positive vesicles only in cells expressing functional SEC62 . This suggests that SEC62 plays a specific role in targeting ER components for degradation after stress resolution.

What are the key unresolved questions about SEC62 function?

Despite significant advances in our understanding of SEC62, several important questions remain:

  • How does SEC62 mechanistically contribute to membrane protein topogenesis beyond its role in the Sec62-Sec63 translocon?

  • What is the molecular basis for SEC62's role in cell proliferation and migration?

  • How is SEC62 function regulated during different cellular states and stress conditions?

  • What is the complete repertoire of SEC62 interaction partners and substrates?

  • How do post-translational modifications of SEC62 affect its various functions?

Addressing these questions will require integrative approaches combining structural biology, proteomics, and advanced cellular imaging techniques.

What emerging technologies are most promising for SEC62 research?

Several cutting-edge technologies hold particular promise for advancing our understanding of SEC62:

TechnologyApplication to SEC62 ResearchPotential Insights
Cryo-electron microscopyStructural analysis of SEC62 in complex with interaction partnersMolecular mechanisms of SEC62 function
Proximity labeling proteomicsIdentification of SEC62 interaction networksNovel functions and regulatory pathways
Live-cell imaging with optogenetic toolsReal-time visualization of SEC62 dynamicsSpatial and temporal regulation of SEC62 activities
Single-cell transcriptomics/proteomicsCell-specific effects of SEC62 perturbationHeterogeneity in SEC62 function across cell types
CRISPR screens with SEC62 domain mutantsSystematic functional analysisStructure-function relationships

These approaches will help resolve the current gaps in our understanding of SEC62 biology and potentially reveal new therapeutic opportunities targeting SEC62-dependent processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.