Recombinant Mouse Translocation protein SEC63 homolog (Sec63)

Shipped with Ice Packs
In Stock

Description

Reconstitution Guidelines

For lyophilized protein preparations, the following reconstitution protocol is recommended:

  1. Briefly centrifuge the vial prior to opening to collect contents at the bottom

  2. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  4. Prepare small working aliquots to avoid repeated freeze-thaw cycles

Repeated freezing and thawing should be strictly avoided as it can lead to protein denaturation and loss of functionality .

Functional Roles in Cellular Processes

Sec63 performs several critical functions in cellular homeostasis, with roles extending beyond its primary function in protein translocation.

Protein Translocation Machinery

The heterotrimeric Sec61 complex and the dimeric Sec62/Sec63 complex are located in the endoplasmic reticulum membrane and play a central role in translocation of nascent and newly synthesized precursor polypeptides into the endoplasmic reticulum . This process involves precise targeting of precursor proteins to the membrane and regulated opening of the polypeptide-conducting Sec61 channel for translocation .

The protein translocation process can be divided into three major steps:

  1. Targeting of nascent and newly synthesized precursor polypeptides to the endoplasmic reticulum membrane

  2. Insertion of the polypeptide into the Sec61 channel

  3. Translocation of the polypeptide across the endoplasmic reticulum membrane

Regulation of Endoplasmic Reticulum Stress Response

Recent research has uncovered an important role for Sec63 in regulating the unfolded protein response (UPR) through interaction with Inositol-requiring enzyme 1 alpha (IRE1α). Sec63 recruits and activates BiP ATPase through its luminal J-domain to bind onto IRE1α, leading to inhibition of higher-order oligomerization and attenuation of IRE1α RNase activity during prolonged endoplasmic reticulum stress .

This regulatory mechanism is critical for cellular adaptation to stress conditions, as in Sec63-deficient cells, IRE1α remains activated for extended periods despite the presence of excess BiP in the endoplasmic reticulum. Research indicates that "the Sec61 translocon bridges IRE1α with Sec63/BiP to regulate the dynamics of IRE1α signaling in cells" .

Role in Prevention of Polycystic Disease

A significant clinical relevance of Sec63 relates to its role in preventing polycystic diseases. Loss of Sec63 function induces cyst formation in both liver and kidney tissues as a result of reduced polycystin-1 (PC1) processing . Interestingly, inactivation of Sec63 induces an unfolded protein response pathway that functions as a protective mechanism against cyst formation .

Specifically, Sec63 deficiency selectively activates the IRE1α-XBP1 branch of the unfolded protein response, and Sec63 has been demonstrated to exist in a complex with polycystin-1. Research findings indicate that "SEC63 function regulates IRE1α/XBP1 activation, SEC63 and XBP1 are required for GPS cleavage and maturation of PC1, and activation of XBP1 can protect against polycystic disease in the setting of impaired biogenesis of PC1" .

Research Applications and Disease Associations

Recombinant Mouse Sec63 protein serves as a valuable tool for investigating various cellular processes and disease mechanisms.

Polycystic Disease Research

Mutations in the gene encoding Sec63 have been directly linked to polycystic liver disease in humans . Mouse models with Sec63 deficiency develop cystic formations in both liver and kidney tissues, making recombinant Sec63 an important tool for understanding the molecular pathogenesis of these conditions and developing potential therapeutic approaches .

The specific relationship between Sec63, XBP1 (X-box binding protein 1), and polycystin-1 processing provides a molecular framework for understanding cyst formation and has implications for developing interventions that might preserve or enhance GPS (G protein-coupled receptor proteolysis site) cleavage of polycystin-1 .

Endoplasmic Reticulum Stress and Cellular Signaling

The role of Sec63 in regulating IRE1α signaling makes it relevant for studies of cellular responses to endoplasmic reticulum stress, which has implications for various conditions including neurodegenerative disorders, diabetes, and cancer .

Apart from its central role in protein translocation, Sec63 contributes to additional signaling functions that are beginning to be appreciated in research contexts. Studies over the past decade have linked mutations, amplifications, and overexpression of SEC genes to various diseases including kidney and liver diseases, diabetes, and human cancer .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sec63; Sec63l; Translocation protein SEC63 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-760
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYRL RLLKPQPNIIPTVKKIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEIK KQYRLLSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA WIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRNM DMKRLIMVLAGASEFDPQYNKDSTSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLKA RVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIIMARSREEREFRAPTLA SLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDRH SLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMAE VFEKEQSICAAEEQPTEDGQSDANKIKAKGGWQQKNKGPKKMPKSKKKKPLKKKPTTVPL PQAKQQKQKQANGVVGSEAAIKEEEDDISDKGSDSEEEETNRDSQSEKEDGSDRESDREQ DEKQSKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKEQ TLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKP VPENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEEGGD
Uniprot No.

Target Background

Function
SEC63, the Translocation protein SEC63 homolog, mediates cotranslational and post-translational transport of specific precursor polypeptides across the endoplasmic reticulum (ER). It is believed to play a supporting role in recognizing precursors with short and nonpolar signal peptides. SEC63 may collaborate with SEC62 and HSPA5/BiP to facilitate the targeting of small presecretory proteins into the SEC61 channel-forming translocon complex, initiating channel opening for polypeptide translocation to the ER lumen. SEC63 is essential for efficient PKD1/Polycystin-1 biogenesis and trafficking to the plasma membrane of the primary cilia.
Gene References Into Functions
  1. SEC63 function regulates IRE1alpha/XBP1 activation. SEC63 and XBP1 are required for GPS cleavage and maturation of PC1, protecting against polycystic disease. PMID: 25844898
  2. The pro-carcinogenic growth behavior of hepatocytes with low SEC63 expression in the murine model suggests a potential role for SEC63 in hepatocarcinogenesis. PMID: 23537056
  3. Knockout of the murine Sec63 gene inhibits transport of precursor proteins into the endoplasmic reticulum. PMID: 22375059
  4. SEC63 gene expression is upregulated and predominantly localized in mouse decidual cells during days 5-8 of pregnancy. PMID: 19208265
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in kidney (at protein level).

Q&A

What is SEC63 and what is its primary function in cells?

SEC63 is an endoplasmic reticulum (ER) membrane protein that serves as a critical component of the protein translocation machinery. It mediates both cotranslational and post-translational transport of precursor polypeptides across the ER membrane . In humans, the canonical protein consists of 760 amino acid residues with a molecular mass of approximately 88 kDa . SEC63 contains three transmembrane domains with its N-terminus positioned in the cytosol. Between the second and third transmembrane domains, SEC63 possesses a luminal J-domain that recruits BiP (Kar2p in yeast), an Hsp70-type chaperone, to the translocation complex . This interaction is crucial for establishing a molecular ratcheting mechanism that drives unidirectional protein translocation into the ER lumen.

How does SEC63 interact with other components of the Sec complex?

SEC63 functions as part of a heptameric complex in yeast that includes Sec61α, Sec61β, Sec61γ, Sec62, Sec71, and Sec72 . The three transmembrane helices of SEC63 bind to both the N- and C-terminal halves of Sec61α, stabilizing the lateral gate of the Sec61 complex in a more open conformation than observed in the ribosome-bound state . This architectural arrangement is crucial for post-translational protein transport.

In mammals, SEC63 primarily associates with SEC61 and SEC62 to form the SEC complex. The cytosolic N-terminal domain of SEC62 interacts with the C-terminus of SEC63, forming a functional unit that regulates the gating of the protein-conducting channel . This hierarchical coordination between SEC63 and SEC62 is essential for activating SEC61 for post-translational protein translocation.

What experimental methods are most effective for detecting recombinant mouse SEC63?

For immunodetection of recombinant mouse SEC63, Western blotting represents the most widely used and reliable method . When performing Western blot analysis, researchers should consider the following protocol recommendations:

  • Use RIPA or NP-40 based lysis buffers containing protease inhibitors

  • Denature samples at 70°C instead of 95°C to prevent aggregation of this multi-pass membrane protein

  • Employ 8-10% SDS-PAGE gels for optimal resolution of the ~88 kDa protein

  • Transfer to PVDF membranes (rather than nitrocellulose) for improved retention of hydrophobic proteins

  • Block with 5% BSA in TBST rather than milk to reduce background

Additional detection methods include immunohistochemistry and ELISA, which are particularly valuable for tissue localization studies and quantitative analysis, respectively . When selecting antibodies, ensure they have been validated specifically for mouse SEC63 to avoid cross-reactivity with other SEC family proteins.

What is the structural basis for SEC63's regulation of the SEC61 translocation channel?

Recent cryo-electron microscopy studies have provided significant insights into how SEC63 regulates the SEC61 translocation channel. The structure of the yeast Sec complex bound to substrate reveals that SEC63 plays a crucial role in stabilizing the open conformation of the SEC61 lateral gate .

SEC63 utilizes its three transmembrane domains to interact with both the N- and C-terminal halves of Sec61α . This interaction induces conformational changes that:

  • Stabilize the lateral gate in a partially open state

  • Facilitate signal sequence insertion into the translocation channel

  • Prevent ribosome binding to the cytosolic face of Sec61α, thereby committing the complex to post-translational translocation

Structural analysis has identified multiple conformational states of the SEC complex (designated as C1 and C2), which differ notably in the arrangement of SEC62, the lateral gate, and the plug domain . These conformational variations likely represent different functional states during the translocation cycle.

The hierarchical activation mechanism involves SEC63 initially priming SEC61 by stabilizing its open conformation, followed by SEC62 further facilitating substrate engagement through its interaction with signal sequences .

How does the J-domain of SEC63 facilitate protein translocation?

The J-domain of SEC63, located in the ER lumen between its second and third transmembrane domains, plays a pivotal role in protein translocation through its interaction with BiP/Kar2p. This interaction represents a classic example of J-domain protein cooperation with Hsp70 chaperones and functions through the following mechanism:

  • The J-domain stimulates the ATPase activity of BiP/Kar2p

  • ATP hydrolysis induces a conformational change in BiP/Kar2p that increases its affinity for the translocating polypeptide

  • BiP/Kar2p binds to the emerging polypeptide on the luminal side of the translocation channel

  • Multiple BiP/Kar2p molecules bind sequentially to the translocating chain

  • This iterative binding creates a molecular ratchet that prevents backward movement and drives unidirectional translocation

This mechanism is particularly important for post-translational protein transport, where the energy normally provided by ribosome binding and GTP hydrolysis in cotranslational translocation is absent. Notably, not all substrates require this SEC63-BiP ratcheting mechanism, explaining why some precursor proteins (such as preprolactin and VSV G protein) can be efficiently translocated without SEC63 involvement, while others (including pERj3, PrP, and ppcecA) are SEC63-dependent .

What substrate specificity does mouse SEC63 exhibit?

The substrate specificity of SEC63 remains incompletely characterized, but current evidence suggests SEC63 exhibits a precursor-specific role in protein translocation. Several studies have identified proteins that show strong dependency on SEC63 for efficient translocation:

SubstrateTypeSEC63 DependencyTranslocation Mode
pERj3ER-resident proteinHighCo-translational (early phase)
PrPGPI-anchored proteinHighCo-translational (early phase)
ppcecASecretory proteinHighCo-translational (early phase)
PreprolactinSecretory hormoneLow/NoneCo-translational
VSV G proteinViral glycoproteinLow/NoneCo-translational
Polycystins I and IIMembrane proteinsHighLikely post-translational

This differential dependency suggests that SEC63 may be particularly important for proteins with certain signal sequence characteristics or folding properties . Research indicates that SEC63, in cooperation with BiP, plays a critical role in the early phase of co-translational transport for specific substrates, influencing their initial insertion into the SEC61 channel.

The mechanism underlying this substrate selectivity remains elusive, and further studies are needed to define the precise molecular determinants that render certain proteins dependent on SEC63 for efficient translocation.

What expression systems are optimal for producing recombinant mouse SEC63?

The expression of functional recombinant mouse SEC63 presents several challenges due to its multi-pass membrane topology and requirement for proper folding within the ER membrane. Based on current research methodologies, the following expression systems have proven effective:

Mammalian Expression Systems:

  • HEK293 cells using pCMV-based vectors provide native glycosylation and proper membrane insertion

  • CHO cells offer high expression yields for large-scale purification

  • Mouse hepatocyte cell lines may provide tissue-relevant post-translational modifications

Insect Cell Expression:

  • Baculovirus-infected Sf9 or Hi5 cells represent an excellent compromise between yield and proper folding

  • Lower cultivation temperature (27°C vs. 37°C) reduces aggregation risk

Yeast Expression:

  • Saccharomyces cerevisiae with its endogenous SEC machinery can express functional mouse SEC63

  • Pichia pastoris may provide higher yields while maintaining proper folding

For optimal results, consider including:

  • N- or C-terminal affinity tags (His6, FLAG, or Strep-tag II) for purification

  • Fluorescent protein fusions (GFP or mCherry) to monitor expression and localization

  • Inducible promoters to control expression levels

  • Signal sequences to ensure proper ER targeting

Purification typically requires careful solubilization using mild detergents (DDM, LMNG, or GDN) or amphipols to maintain native conformation and functionality of this multi-pass membrane protein.

How can researchers accurately assess SEC63 function in protein translocation assays?

Evaluating SEC63 function in protein translocation requires specialized assays that can distinguish between SEC63-dependent and independent pathways. The following methodological approaches are recommended:

In vitro Translation/Translocation Assays:

  • Prepare microsomal membranes from SEC63-expressing or SEC63-depleted cells

  • Synthesize radiolabeled precursor proteins using reticulocyte lysate or wheat germ extract

  • Incubate precursors with microsomes under various conditions

  • Assess translocation by protease protection assays, glycosylation status, or signal sequence cleavage

  • Compare translocation efficiency between SEC63-containing and SEC63-depleted microsomes

Cell-Based Translocation Reporters:

  • Design dual reporter constructs containing SEC63-dependent and independent substrates

  • Fuse reporters to split fluorescent or enzymatic proteins that activate upon successful translocation

  • Express in cells with normal or reduced SEC63 levels

  • Quantify translocation efficiency using flow cytometry or plate reader-based assays

Cross-Linking and Co-Immunoprecipitation:

  • Use bifunctional cross-linkers to capture transient interactions during translocation

  • Perform sequential immunoprecipitation using SEC63 antibodies followed by substrate-specific antibodies

  • Analyze interaction partners by mass spectrometry to identify novel SEC63-dependent substrates

For analyzing SEC63 dependency in specific substrates, siRNA-mediated knockdown or CRISPR/Cas9 knockout approaches can be combined with pulse-chase experiments to monitor translocation kinetics in living cells.

What methods are most effective for studying SEC63's interaction with BiP/Kar2p?

The interaction between SEC63's J-domain and BiP/Kar2p represents a critical aspect of its function in protein translocation. The following methods provide robust approaches for investigating this interaction:

Surface Plasmon Resonance (SPR):

  • Immobilize purified J-domain fragments on sensor chips

  • Flow BiP/Kar2p over the surface at various concentrations

  • Measure association and dissociation rates

  • Determine the impact of ATP/ADP on binding kinetics

  • Assess how mutations in the J-domain affect BiP/Kar2p recruitment

Fluorescence Resonance Energy Transfer (FRET):

  • Tag SEC63 and BiP with appropriate FRET pairs (CFP/YFP or similar)

  • Express in ER membranes of living cells

  • Measure FRET efficiency under various conditions (ATP depletion, ER stress, etc.)

  • Use acceptor photobleaching to confirm specific interactions

ATPase Stimulation Assays:

  • Purify recombinant J-domain fragments

  • Measure BiP/Kar2p ATPase activity using colorimetric phosphate release assays

  • Determine stimulation of ATPase activity by wild-type and mutant J-domains

  • Correlate ATPase stimulation with translocation efficiency

These approaches, combined with structural studies using cryo-EM or X-ray crystallography, provide complementary insights into the molecular mechanisms governing SEC63-BiP/Kar2p cooperation during protein translocation.

How do SEC63 mutations contribute to polycystic liver disease?

SEC63 has been established as a causative gene in autosomal dominant polycystic liver disease (ADPLD), with several loss-of-function mutations identified in affected individuals . These mutations include frameshifts, nonsense mutations, and splice site disruptions that lead to loss of gene function .

The pathogenesis of ADPLD due to SEC63 mutations involves impaired cotranslational transport of specific proteins, most notably polycystins I and II . These proteins are essential for maintaining proper bile duct structure and function. The molecular mechanism underlying cyst formation appears to involve:

  • Reduced efficiency of polycystin translocation into the ER

  • Impaired quality control of polycystins in the ER

  • Disrupted delivery of polycystins to their functional sites in the cell

  • Subsequent dysregulation of cellular signaling pathways that control ductal cell proliferation and fluid secretion

Mouse models with SEC63 deficiency recapitulate key features of human polycystic liver disease, confirming the causal relationship between SEC63 dysfunction and cyst formation. These models have provided valuable insights into the temporal progression of the disease and potential therapeutic targets.

What evidence supports SEC63's role as a tumor suppressor?

Several lines of evidence suggest that SEC63 may function as a tumor suppressor in certain cancer types:

  • Frameshift mutations caused by microsatellite instability have been identified in SEC63 across multiple cancer types:

    • 37.5% of microsatellite-unstable gastric cancers

    • 48.8% of colorectal cancers

    • 56% of small-bowel cancer associated with hereditary non-polyposis colorectal cancer

    • Isolated cases of hepatocellular carcinoma associated with Lynch syndrome

  • Functional studies in mouse models (BXD mice) have demonstrated that low hepatic expression of SEC63 correlates with:

    • Decreased apoptosis rates in hepatocytes

    • Increased proliferative activity of hepatocytes

  • The pattern of mutations (predominantly frameshifts and nonsense mutations) is consistent with loss-of-function alterations typical of tumor suppressor genes

While these findings strongly suggest a tumor suppressor role for SEC63, the precise molecular mechanisms remain incompletely understood. Current hypotheses include:

  • Disrupted translation of key tumor suppressor proteins

  • Altered ER stress responses affecting cell survival pathways

  • Impaired calcium homeostasis influencing apoptotic signaling

  • Dysregulated unfolded protein response affecting cell proliferation

Further research is needed to clarify the exact mechanisms by which SEC63 deficiency contributes to tumorigenesis and to determine whether this represents a potential therapeutic vulnerability in affected cancers.

How does SEC63 interact with SEC62 in physiological and pathological contexts?

The interaction between SEC63 and SEC62 is crucial for normal protein translocation but may also contribute to disease processes when dysregulated. The SEC62-SEC63 complex functions in a hierarchical manner to activate the SEC61 channel for post-translational protein translocation .

In normal physiology:

  • SEC63 primarily acts as an initial activator of SEC61, stabilizing its open conformation

  • SEC62 contains two transmembrane domains and interacts with SEC63 via its cytosolic N-terminal domain

  • This interaction positions SEC62 near the signal sequence insertion site in the SEC61 complex

  • Together, they facilitate efficient post-translational protein import into the ER

In pathological contexts, an imbalance between SEC62 and SEC63 levels may disrupt normal translocation processes:

ConditionSEC62 StatusSEC63 StatusPotential Consequences
ADPLDNormalLoss-of-function mutationsImpaired translocation of specific substrates (e.g., polycystins)
Various cancersOverexpressedFrequently mutatedEnhanced cell migration and invasion; altered calcium homeostasis
ER stress conditionsMay be upregulatedUnknownAltered ER-phagy; disrupted ER stress responses

Interestingly, while SEC63 often displays tumor suppressor characteristics, SEC62 overexpression has been observed in various cancers, including prostate, lung, thyroid, and cervical cancers . SEC62 overexpression correlates with increased migration and invasion of cancer cells, though the exact mechanism remains unclear . This opposing pattern suggests that the balance between these two interacting proteins may be critical for normal cellular function.

What are the emerging technologies for studying SEC63 dynamics during translocation?

Recent technological advances have opened new avenues for investigating SEC63 dynamics during the translocation process:

Cryo-Electron Microscopy (Cryo-EM):
Recent structural studies have successfully captured different conformational states of the SEC complex during translocation . These approaches have revealed distinct conformations (designated C1 and C2) that differ in the arrangement of SEC62, the lateral gate, and the plug domain . Advanced time-resolved cryo-EM techniques may soon allow visualization of the complete translocation cycle at near-atomic resolution.

Single-Molecule Fluorescence:

  • Site-specific fluorophore incorporation using unnatural amino acids

  • Real-time tracking of individual translocation events

  • Measurement of SEC63 conformational changes during substrate processing

  • Determination of kinetic parameters for different substrate classes

CRISPR-Based Genome Engineering:

  • Introduction of endogenous tags at the SEC63 locus

  • Creation of conditional knockout models for temporal control

  • Base editing to introduce disease-associated mutations

  • Prime editing for precise modification of SEC63 functional domains

These emerging technologies promise to provide unprecedented insights into SEC63 function and may reveal new therapeutic opportunities for SEC63-associated diseases.

How can computational approaches enhance our understanding of SEC63 function?

Computational methodologies offer powerful complementary approaches to experimental studies of SEC63:

Molecular Dynamics Simulations:

  • Modeling of SEC63's interactions with the lipid bilayer

  • Simulation of conformational changes during substrate engagement

  • Prediction of binding interfaces with SEC61, SEC62, and substrate proteins

  • Energetic analysis of disease-causing mutations

Machine Learning Approaches:

  • Prediction of SEC63-dependent substrates based on signal sequence features

  • Identification of potential regulatory sites from evolutionary conservation patterns

  • Classification of mutations as pathogenic or benign based on structural context

  • Integration of multi-omics data to identify SEC63-regulated pathways

Systems Biology Models:

  • Quantitative modeling of the complete translocation process

  • Prediction of cell-type specific effects of SEC63 mutations

  • Simulation of compensatory mechanisms in disease states

  • Network analysis of SEC63 interactions in various cellular contexts

These computational approaches, when integrated with experimental data, provide a more comprehensive understanding of SEC63 function in health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.