Buffer
Lyophilized from PBS, containing 6% Trehalose, pH 7.4.
Form
Lyophilized powder
Note: We will default ship the product in lyophilized form with normal blue ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice. Please communicate with us in advance as extra fees for dry ice and a dry ice box will be charged.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. Upon receipt, store the protein at -20°C/-80°C, ensuring to avoid repeated freezing and thawing, as this can negatively impact protein activity.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
C-terminal 10xHis-tagged
If you have a specific tag type in mind, please let us know, and we will investigate the feasibility of development.
Synonyms
Tspo; Bzrp; Mbr; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
Datasheet & Coa
Please contact us to get it.
Expression Region
1-169aa
Species
Mus musculus (Mouse)
Target Protein Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.