Recombinant Mouse Translocator protein (Tspo)

Shipped with Ice Packs
In Stock

Description

Definition and Recombinant Production

Recombinant mouse TSPO is a genetically engineered form of the 18 kDa transmembrane protein expressed in mitochondrial membranes. It is synthesized via bacterial, yeast, or mammalian systems to study its structure, function, and interactions with ligands like PK11195 . Native TSPO binds cholesterol and regulates steroidogenesis, while recombinant variants enable precise biochemical and structural analyses .

Functional Roles in Biological Systems

Recombinant TSPO studies reveal diverse roles, though its necessity in some pathways remains debated:

RoleMechanismKey FindingsReference
Cholesterol TransportFacilitates cholesterol import into mitochondria for steroidogenesisTSPO deletion in Leydig cells did not impair testosterone synthesis
Apoptosis RegulationModulates mitochondrial permeability transition pore (mPTP) activityOverexpression in astrocytes alters glucose metabolism and inflammation
Cardiac RegulationInteracts with voltage-dependent calcium channels to modulate contractilityUpregulation during infection limits inflammatory damage to cardiomyocytes

Expression Regulation and Inflammatory Responses

TSPO expression is dynamically regulated, particularly in neuroinflammation:

RegulatorMechanismExperimental EvidenceReference
LPS StimulationActivates AP-1 complex (c-Fos/c-Jun) binding to enhancer regionsLPS-induced Tspo mRNA increased 3.8-fold in microglial BV-2 cells
Sp1 Transcription FactorEnhances basal expression via proximal promoter bindingSp1 enrichment increased at TSS under LPS, correlating with TSPO upregulation
HDAC1Inhibits enhancer activity; LPS reduces HDAC1 binding to AP-1 siteHDAC1 depletion at enhancer increased Tspo transcription

Research Applications

Recombinant TSPO enables targeted studies in neurodegeneration, oncology, and behavioral disorders:

ApplicationApproachOutcomeReference
Neuroinflammation ImagingPET ligands (e.g., [18F]DPA-714) bind TSPO in microgliaDetected in 80% of breast cancer xenografts; stromal TSPO colocalizes with macrophages
Anxiety ModelsViral overexpression in dentate gyrus (DG) reduces contextual freezingTSPO overexpression reversed foot-shock-induced anxiety in mice
Cancer BiologyTSPO expressed in tumor cells and macrophagesHigh TSPO in 20/25 breast cancer xenografts; linked to poor prognosis
Astrocyte ReactivityAlters glucose metabolism and pro-inflammatory responsesLPS increased mitochondrial density and TSPO expression in astrocytes

Controversies and Future Directions

While TSPO is critical for cholesterol transport in vitro, its necessity in vivo remains unclear. Knockout studies show compensatory pathways in steroidogenesis . Future research using recombinant TSPO should:

  • Resolve Structural Ambiguities: Clarify monomer vs. dimer states in different conditions.

  • Target Inflammatory Pathways: Develop TSPO ligands to modulate neuroinflammation or cancer progression.

  • Explore Cardiovascular Roles: Investigate TSPO’s protective effects in cardiac stress responses .

Product Specs

Buffer
Lyophilized from Tris/PBS-based buffer, containing 6% Trehalose.
Form
Available in both liquid and lyophilized powder formats.
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request accordingly.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Synonyms
Tspo; Bzrp; Mbr; Translocator protein; Mitochondrial benzodiazepine receptor; PKBS; Peripheral-type benzodiazepine receptor; PBR
Datasheet & Coa
Please contact us to get it.
Expression Region
1-169aa
Mol. Weight
21.7 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This protein is capable of binding protoporphyrin IX and may play a role in the transport of porphyrins and heme. It was initially identified as a peripheral-type benzodiazepine receptor, and can also bind isoquinoline carboxamides. This protein promotes the transport of cholesterol across mitochondrial membranes and may participate in lipid metabolism. However, its precise physiological role remains controversial. According to certain reports, it is not essential for steroid hormone biosynthesis.
Gene References Into Functions
  1. Elevated TSPO expression marks a pro-inflammatory brain environment, which is not necessarily accompanied by neuronal loss. PMID: 28695372
  2. The tertiary and quaternary structure of the mitochondrial translocator protein TSPO, which binds cholesterol with nanomolar affinity, is influenced by cholesterol. PMID: 28358007
  3. Steroidogenic abnormalities in TSPO-knockout mice and their significance in aging males have been reported. PMID: 29127254
  4. Results indicate that TSPO overexpression in the hippocampal dentate gyrus can significantly exert anxiolytic and antidepressant-like effects on behavior. These effects are associated with allopregnanolone biosynthesis, which is at least partially mediated by TSPO. PMID: 28655607
  5. TSPO is therefore proposed as a novel outer mitochondrial membrane-based pathway to control intracellular Ca(2+) dynamics and redox transients in neuronal cytotoxicity. PMID: 28640253
  6. TSPO plays a critical role in steroid biosynthesis and may function, at least in part, through its regulation of DeltaPsim and effects on STAR. PMID: 29300865
  7. Results showed that TSPO and other mitophagy-related proteins, such as VDAC1, Pink1 and Beclin1, were significantly decreased by LH challenge. Furthermore, KIFC2, involved in mitochondrial transport, and Snap25, involved in neurotransmitter vesicle release, were also downregulated in the LH mice, providing further evidence for the existing mitochondrial dysfunction in these animals. PMID: 27543827
  8. A potential modulatory role of TSPO is observed in response to immune system deficit. PMID: 28189343
  9. TSPO expression was found to be increased in the peri-hematomal brain region after intracerebral hemorrhage. PMID: 27315802
  10. TSPO expression increases (approximately 9-fold) in rodent-derived macrophages and microglia upon pro-inflammatory stimulation. PMID: 28530125
  11. Data suggest that up-regulation of translocator protein 18kDa level during neuroinflammation may be an adaptive response mechanism, a way to provide more neurosteroids. PMID: 27265418
  12. This study confirms that TSPO deficiency does not affect viability and bronchial alveolar immune homeostasis. PMID: 27907096
  13. These results suggest that Wuling powder exhibited an obvious antidepressant effect, which could be due to the improvement of the TSPO-mediated mitophagy signaling pathway. PMID: 27063986
  14. The loss of TSPO in the Central Nervous System did not result in overt developmental defects or phenotypes. The TSPO-/- mouse showed a decrease in glial fibrillary acidic protein expression, correlating with a decrease in astrogliosis in response to neural injury during Autoimmune Experimental Encephalomyelitis. PMID: 26925573
  15. This study reviews the physiological functions of the TSPO gene in the mitochondrial permeability transition pore, steroidogenesis, and energy metabolism, especially in knockout mice. [review] PMID: 26551692
  16. This study highlights the 3D structure of mTSPO/PBR and in complex with PK11195, providing an important step towards a more detailed understanding of the molecular mechanism of mammalian TSPO/PBR and its interaction with small molecules. [review] PMID: 26551694
  17. TSPO expression in Sandhoff disease mice is brain region-specific and depends on the age of the animal as disease progresses, with the thalamus providing the earliest signal of disease based on TSPO expression and other markers of neurodegeneration. PMID: 26545928
  18. TSPO deficiency does not adversely affect erythropoiesis, heme biosynthesis, bioconversion of ALA to PPIX, and porphyrin-mediated phototoxic cell death. PMID: 26627829
  19. TSPO can affect mitochondrial energy homeostasis through modulation of fatty acid oxidation, a function that appears to be consistent with high levels of TSPO expression observed in cell types active in lipid storage/metabolism. PMID: 26741196
  20. The three-dimensional structure and side-chain dynamics of the A147T polymorph of mouse TSPO in complex with the first-generation ligand PK11195 were determined. PMID: 25974690
  21. This report describes novel imidazo[1,2-a]pyridine-based TSPO ligands endowed with potential in modulating the steroidogenesis process in murine Leydig tumor cells. PMID: 26002041
  22. TSPO is identified as a novel element in the regulation of mitochondrial quality control by autophagy, and this study demonstrates the importance for cell homeostasis of its expression ratio with voltage-dependent anion channel 1. PMID: 25470454
  23. TPSO knockout mice exhibit normal growth, lifespan, cholesterol transport, blood pregnenolone level, protoporphyrin IX metabolism, fertility, and behavior. Activation of microglia after neuronal injury appears unimpaired, but microglia produce less ATP. PMID: 25406832
  24. Data suggest that Tspo expression is tightly associated with the metabolic state of adipocytes and the differentiation of preadipocytes into white/brown adipocytes. Tspo expression may improve the metabolic status of adipocytes and regulate glucose homeostasis. PMID: 26123521
  25. TSPO was found to be necessary for preimplantation embryo development and ACTH-stimulated steroid biosynthesis. PMID: 26039990
  26. This study reported on the generation of TSPO-knockout MA-10 mouse Leydig tumor cells and examined their steroidogenic potential after exposure to either dibutyryl-cAMP or PK11195. PMID: 25535830
  27. Data indicate that knockdown of translocator protein TSPO by siRNA had no effect on the productions of TNF-alpha, IL-1beta, and IL-6 in lipopolysaccharide (LPS)-stimulated BV-2 microglia cells. PMID: 25200148
  28. Up-regulation of TSPO in microglia occurs during neuroinflammation. PMID: 24687172
  29. TSPO participates in a number of pathological processes through its actions on the PTP. PMID: 24692541
  30. TSPO knock-out mice are viable with no effects on steroidogenesis. PMID: 24936060
  31. TSPO expression is able to distinguish differences in the severity of myocarditis between male subjects and female subjects. PMID: 24402571
  32. A reduction in TSPO gene expression is observed in whole tissue extracts. PMID: 24260329
  33. TSPO expression in both male and female reproductive tissues is not only restricted to steroidogenic cells. PMID: 24040265
  34. The 3D structure of TSPO in complex with its ligand PK11195 has been elucidated. The TSPO-PK11195 structure is characterized by a tight bundle of 5 transmembrane alpha helices that form a hydrophobic pocket accepting PK11195. Ligand-induced stabilization of the TSPO structure suggests a molecular mechanism for stimulation of cholesterol transport into mitochondria. PMID: 24653034
  35. TSPO function is not essential for steroid hormone biosynthesis. PMID: 24174323
  36. Upregulation of TSPO expression is increased during microglial inflammation. PMID: 22874716
  37. This study analyzes central nervous system expression and PET imaging of the translocator protein in relapsing-remitting experimental autoimmune encephalomyelitis. PMID: 23321458
  38. Different amino acid compositions and the location of the polyhistidine tag between bacterial and mouse TSPO could account for the formation of dimer versus tetramer, respectively. PMID: 22771765
  39. The results suggest a new micro-transcriptional mechanism that regulates Tspo expression and thus steroidogenesis via an intron-based SINE B2-driven natural antisense transcript specific for the Tspo gene. PMID: 22378763
  40. This study investigates the expression of TSPO in small rodent bone tissues. PMID: 22295097
  41. Translocator protein (TSPO) expression is upregulated in cerebral regions of ob/ob leptin-deficient mice. PMID: 21299850
  42. Novel androstenetriol interacts with the mitochondrial translocator protein and controls steroidogenesis. PMID: 21209087
  43. The clinical consequences of secondary neuronal degeneration in stroke might be better treated thanks to the discrimination of neuronal processes using in vivo molecular imaging and potent TSPO radioligands like CLINDE to guide therapeutic interventions. PMID: 20814674
  44. In conclusion, [(11)C]DAC PET responded to the change in PBR expression in tumors caused by carbon ion irradiation in this study. PMID: 19851043
  45. The capacity of PK11195 to suppress the pathogenesis of microphthalmia implies a critical role for mitochondrial peripheral benzodiazepine receptors in the p53-dependent mode of action of 2CdA on ocular development. PMID: 12769506
  46. Two Sp1/Sp3 sites in the proximal promoter are important for basal activity in all cell lines tested, and steroidogenic MA-10 and Y1 cells use different areas of the promoter compared with nonsteroidogenic NIH-3T3 cells. PMID: 14630713
  47. PBR deregulation plays a role in human malignancy [isoquinoline-binding protein]. PMID: 15379570
  48. Both StAR and PBR proteins are indispensable elements of the steroidogenic machinery and function in a coordinated manner to transfer cholesterol into mitochondria. PMID: 15498831
  49. The CRAC domain in the cytosolic carboxyl-terminal domain of PBR might be responsible for the uptake and translocation of cholesterol into the mitochondria. PMID: 15528269
  50. This study is the first to show that peripheral benzodiazepine receptor and DRM/gremlin are expressed in preadipocyte cell lines and that they are differentially regulated during adipogenesis. PMID: 15919833

Show More

Hide All

Database Links

KEGG: mmu:12257

STRING: 10090.ENSMUSP00000037039

UniGene: Mm.1508

Protein Families
TspO/BZRP family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in liver (at protein level). Ubiquitous.

Q&A

What is Mouse Translocator Protein (TSPO) and what are its key characteristics?

Mouse Translocator protein (TSPO) is an 18 kDa evolutionary conserved protein primarily located in the mitochondrial membrane. It is also known by several synonyms including PBR (Peripheral-type benzodiazepine receptor), Mitochondrial benzodiazepine receptor, PKBS, Bzrp, and Mbr . The protein consists of 169 amino acids with a molecular weight of 18,841 Da . TSPO is characterized as a multi-pass membrane protein that spans the mitochondrial membrane multiple times, creating a channel-like structure. The mouse TSPO gene is located on chromosome 15 and is assigned the NCBI Gene ID 12257 . In terms of protein structure, TSPO forms homo-oligomers and can interact with several partner proteins including TSPOAP1 (also known as BZRAP1), MOST-1, and potentially with STAR (Steroidogenic Acute Regulatory protein) .

What are the primary physiological functions of TSPO in normal mouse tissues?

TSPO demonstrates several important physiological functions in mouse tissues. It can bind protoporphyrin IX and likely participates in the transport of porphyrins and heme across mitochondrial membranes . Originally identified as a peripheral-type benzodiazepine receptor, TSPO binds isoquinoline carboxamides and promotes cholesterol transport across mitochondrial membranes . It may play a significant role in lipid metabolism, although its precise physiological function remains controversial with some reports indicating it is not required for steroid hormone biosynthesis . Recent knockout studies have raised questions about TSPO's purported central role in steroidogenesis, suggesting a more complex or regulatory function rather than an essential biosynthetic one . TSPO is involved in multiple biological processes including behavioral responses to pain, chloride transport, glial cell migration, lipid transport, and regulation of steroid biosynthesis . It also appears to participate in the negative regulation of nitric oxide biosynthesis and tumor necrosis factor production, while positively regulating apoptosis and calcium ion transport .

What methods are most effective for detecting mouse TSPO in experimental samples?

For quantitative detection of mouse TSPO in experimental samples, sandwich ELISA represents one of the most effective and widely used methods. Commercially available ELISA kits can accurately detect TSPO in mouse serum, plasma, tissue homogenates, cell culture supernatants, and other biological fluids . These assays typically offer detection ranges between 0.312-20 ng/mL with sensitivities as low as 0.156 ng/mL . The sandwich ELISA format provides high specificity for both natural and recombinant mouse TSPO . When performing ELISA-based detection, researchers should adhere to manufacturer guidelines regarding sample preparation, dilution factors, and incubation times to achieve optimal results. For detection in tissue sections, immunohistochemistry using validated anti-TSPO antibodies can effectively visualize protein localization. Additionally, radioligand binding assays using selective TSPO ligands such as PK 11195, CLINDE, or PBR11 provide another avenue for detection, especially when combined with autoradiography or PET imaging . When selecting a detection method, researchers should consider factors including required sensitivity, sample type, availability of equipment, and whether quantitative or qualitative data is needed.

What are the primary structural features of TSPO that contribute to its functional properties?

TSPO's structural features directly contribute to its functional properties. Recent advances in protein structural analysis have revealed that TSPO forms a channel-like structure with multiple transmembrane domains spanning the mitochondrial membrane . This structure is consistent with its purported role in cholesterol transport and cell metabolism . The protein can adopt different conformations depending on the environment, oligomerization state, and interaction partners . The binding of ligands like PK 11195 can stabilize certain conformations of TSPO, which was instrumental in solving its three-dimensional structure . TSPO's ability to form homo-oligomers and interact with partner proteins such as TSPOAP1 and STAR further contributes to its functional versatility . The channel-like architecture facilitates the translocation of molecules such as cholesterol and porphyrins across the mitochondrial membrane, while its binding domains for benzodiazepines and isoquinoline carboxamides suggest roles in signaling or regulatory processes . These structural characteristics support TSPO's involvement in diverse cellular processes including steroid biosynthesis, mitochondrial function, and cellular responses to stress and inflammation.

What are the implications of TSPO polymorphisms for experimental design using recombinant mouse TSPO?

TSPO polymorphisms have significant implications for experimental design using recombinant mouse TSPO. While the search results don't explicitly address mouse TSPO polymorphisms, the existence of genetic variations in TSPO could affect ligand binding affinity, protein expression levels, and functional properties. When designing experiments with recombinant mouse TSPO, researchers must consider the specific genetic background of the recombinant protein and ensure consistency across experimental batches. Different polymorphic variants might respond differently to experimental manipulations, potentially introducing confounding variables. For instance, if studying ligand binding characteristics, researchers should specify which TSPO variant is being used, as binding affinities could vary between polymorphic forms. Similarly, when comparing results across studies, attention should be paid to the genetic background of the TSPO being investigated. Creating recombinant TSPO proteins with specific polymorphisms could serve as a valuable approach to studying the functional consequences of these genetic variations. Additionally, when designing experiments with knockout or knock-in models, the baseline genetic background becomes crucial for proper interpretation of results, especially when reintroducing recombinant TSPO into null backgrounds.

What approaches can resolve contradictory findings regarding TSPO's role in steroidogenesis?

Resolving contradictory findings regarding TSPO's role in steroidogenesis requires multifaceted approaches that address methodological differences and biological complexity. First, researchers should conduct carefully controlled comparative studies using both pharmacological TSPO modulation and genetic approaches (knockout, knockdown, overexpression) within the same experimental framework to determine whether discrepancies arise from methodological differences or compensatory mechanisms. Second, temporal dynamics must be considered—acute pharmacological inhibition versus chronic genetic deletion may yield different results due to compensatory mechanisms that develop over time in knockout models. Third, context-dependent functions should be explored, as TSPO's role may vary across different steroidogenic tissues, developmental stages, or stress conditions. Advanced techniques like conditional and inducible knockouts can help dissect these contextual dependencies. Fourth, researchers should investigate potential redundancy and compensatory pathways that might mask TSPO's function in knockout models by performing comprehensive omics analyses (transcriptomics, proteomics, metabolomics) comparing wild-type and TSPO-deficient systems. Finally, structural studies examining TSPO-cholesterol interactions and TSPO oligomerization under different conditions could provide mechanistic insights into how TSPO might regulate rather than directly facilitate steroid synthesis . Collectively, these approaches acknowledge that gene "functions" are emergent properties of complex interactions and cannot always be definitively determined through single-approach studies .

How can researchers effectively distinguish between specific and non-specific effects of TSPO ligands in experimental systems?

Researchers can effectively distinguish between specific and non-specific effects of TSPO ligands through several complementary approaches. First and foremost, utilizing TSPO knockout models provides the most definitive method for identifying off-target effects. The GuwiyangWurra TSPO knockout mouse has proven valuable for confirming the selectivity of TSPO-targeting drugs like PK 11195, CLINDE, and PBR11 . Researchers can conduct parallel experiments in wild-type and TSPO-null backgrounds to directly attribute effects to TSPO binding. Second, implementing concentration-response curves with multiple structurally diverse TSPO ligands can distinguish between class effects (shared by multiple ligands) and compound-specific effects. Third, competitive binding assays with known TSPO ligands help verify target engagement and specificity. Fourth, researchers should utilize molecular and cellular readouts known to be directly downstream of TSPO activation as positive controls for specific engagement. Fifth, chimeric experimental systems, such as the model where TSPO-expressing tumors grow in TSPO-null backgrounds, provide elegant approaches to isolate TSPO-specific effects . Finally, researchers should employ comprehensive pharmacological profiling against potential off-target receptors, channels, and enzymes. The search results emphasize that TSPO null-background animals are particularly useful in addressing questions about target selectivity and off-target effects of TSPO-binding drugs prior to clinical trials , highlighting the importance of these approaches in minimizing late-stage failure in drug development.

What are the optimal conditions for expressing and purifying recombinant mouse TSPO?

For optimal expression and purification of recombinant mouse TSPO, researchers should consider several critical factors due to its nature as a multi-pass membrane protein. Expression systems should be carefully selected, with bacterial systems (E. coli) offering high yield but potentially compromising proper folding, while eukaryotic systems (yeast, insect cells, mammalian cells) may provide better folding and post-translational modifications despite lower yields. For bacterial expression, fusion tags (such as His6, MBP, or GST) can improve solubility and facilitate purification, while codon optimization may enhance expression efficiency. Since TSPO is a membrane protein, detergent selection is crucial—mild non-ionic detergents like DDM, LDAO, or Triton X-100 help solubilize TSPO while preserving its native conformation. Temperature modulation during expression (typically lowering to 16-20°C) can improve proper folding, while IPTG concentration needs optimization for induction. Purification typically involves affinity chromatography utilizing fusion tags, followed by size exclusion chromatography to remove aggregates and obtain homogeneous protein. Quality control should include ligand binding assays (using PK 11195 or other established ligands) to confirm functionality , SDS-PAGE and Western blotting for purity and identity verification, and mass spectrometry for accurate mass determination. For structural studies, conditions that stabilize TSPO's conformation (as achieved with PK 11195 for structural determination) should be considered throughout the purification process.

What experimental controls are essential when measuring TSPO expression levels in neuroinflammatory disease models?

When measuring TSPO expression levels in neuroinflammatory disease models, several essential experimental controls must be implemented. First, researchers should include both positive and negative tissue controls—steroidogenic tissues (adrenal glands, testes) serve as positive controls due to their high constitutive TSPO expression , while TSPO knockout tissues provide definitive negative controls to validate antibody or ligand specificity . Time-course controls are essential, as TSPO expression changes dynamically during disease progression—multiple time points should be analyzed to capture the full expression profile. Disease severity controls should correlate TSPO expression with established markers of neuroinflammation (such as microglial activation markers) and disease severity metrics to contextualize expression changes. Cell-type specific markers (for microglia, astrocytes, neurons, and other CNS cells) should be co-stained with TSPO to identify the cellular sources of altered expression. Technical method validation should include antibody validation using knockout tissues , multiple antibodies targeting different epitopes, and complementary techniques (qPCR, Western blot, immunohistochemistry, and radioligand binding) to confirm changes in expression. Finally, treatment intervention controls should evaluate how known modulators of neuroinflammation affect TSPO expression to establish causality between neuroinflammatory processes and TSPO upregulation. These comprehensive controls help distinguish specific neuroinflammation-related changes in TSPO expression from artifacts or non-specific variations.

How should researchers design experiments to investigate TSPO's role in mitochondrial function?

Designing experiments to investigate TSPO's role in mitochondrial function requires a comprehensive approach that captures both direct and indirect effects. Researchers should first establish relevant mitochondrial function readouts, including oxygen consumption rate (OCR), extracellular acidification rate (ECAR), ATP production, membrane potential (using indicators like TMRM or JC-1), reactive oxygen species production, and calcium handling. Genetic manipulation approaches should compare wild-type cells/tissues with those where TSPO is knocked out, knocked down (siRNA/shRNA), or overexpressed to establish causal relationships. Pharmacological approaches should use selective TSPO ligands (PK 11195, CLINDE, PBR11) alongside appropriate vehicle controls, with dose-response curves and competitive antagonism to confirm specificity. Given the latent phenotype observed in TSPO knockout studies affecting mitochondrial ATP production , stress conditions (such as nutrient deprivation, oxidative stress, or inflammatory stimulation) may be necessary to unveil TSPO-dependent changes in mitochondrial function. Cell-type specific analyses should compare effects across different cell types (neurons, astrocytes, microglia) given the varying expression and potentially different functions of TSPO across cell types. Temporal dynamics should be considered through time-course experiments that distinguish acute from chronic effects of TSPO modulation. Subcellular localization studies should use high-resolution imaging to track TSPO's association with mitochondrial structures and potential interaction partners. These approaches collectively address the complex regulatory influence TSPO may exert on mitochondrial function despite its apparent non-essentiality .

What are the most reliable methods for studying TSPO-ligand interactions in mouse models?

For studying TSPO-ligand interactions in mouse models, researchers should employ multiple complementary approaches to ensure reliability. In vivo PET imaging using radiolabeled TSPO ligands offers valuable spatial and temporal information about ligand binding in living animals, with micro-PET having been successfully used in the GuwiyangWurra TSPO knockout mouse to confirm ligand selectivity . Ex vivo autoradiography provides higher spatial resolution for detailed mapping of ligand binding distribution in tissue sections, allowing for comparison between wild-type and knockout tissues . In vitro binding assays using membrane preparations or cell homogenates enable quantitative determination of binding parameters (Kd, Bmax) for different ligands, while competition binding assays can determine the relative affinities of unlabeled compounds. Cellular functional assays measuring relevant downstream effects (mitochondrial membrane potential, calcium flux, steroid production) help connect binding to functional outcomes. The chimeric tumor model approach, where TSPO-expressing tumors grow in TSPO-knockout hosts, provides an elegant system for evaluating binding specificity in a mixed environment . Pharmacokinetic studies should assess blood-brain barrier penetration, tissue distribution, and clearance of TSPO ligands. Finally, comparing results across different ligand classes (isoquinoline carboxamides like PK 11195, imidazopyridines like CLINDE and PBR11) helps distinguish TSPO-specific from non-specific effects. These methods collectively provide robust evidence of TSPO-ligand interactions while addressing potential confounding factors.

What standardized protocols ensure reproducible results when using ELISA to quantify mouse TSPO?

Ensuring reproducible results when using ELISA to quantify mouse TSPO requires strict adherence to standardized protocols. First, sample collection and processing must be consistent—standardize the time of collection, processing methods, and storage conditions (typically -80°C with minimal freeze-thaw cycles). Sample preparation should follow validated protocols for each sample type, with standardized lysis buffers for tissue homogenates and consistent dilution factors for all samples to ensure measurements fall within the standard curve range (0.312-20 ng/mL for typical TSPO ELISA kits) . Quality control measures should include running duplicate or triplicate samples to assess technical variation, using positive controls (samples with known TSPO content), negative controls (samples from TSPO knockout mice) , and spike-recovery tests to assess matrix effects. The standard curve preparation requires careful attention—use freshly prepared standards for each assay from lyophilized stock , ensure proper reconstitution according to manufacturer instructions, and prepare a complete standard curve with sufficient points to cover the expected concentration range. Assay conditions must be standardized, including consistent incubation times and temperatures, uniform washing procedures (typically using provided wash buffer) , and controlled environmental conditions (temperature, humidity) during the assay. Data analysis should employ consistent calculation methods for standard curves (typically 4 or 5-parameter logistic regression), apply the same outlier identification criteria across experiments, and normalize results when appropriate (e.g., to total protein content). The table below summarizes key ELISA components and storage conditions:

ComponentQuantity (96 Assays)Storage
ELISA Microplate (Dismountable)8×12 strips-20°C
Lyophilized Standard2-20°C
Sample Diluent20ml-20°C
Assay Diluent A10mL-20°C
Assay Diluent B10mL-20°C
Detection Reagent A120μL-20°C
Detection Reagent B120μL-20°C
Wash Buffer30mL4°C
Substrate10mL4°C
Stop Solution10mL4°C
Plate Sealer5-

How should researchers interpret changes in TSPO expression in relation to disease progression?

Interpreting changes in TSPO expression in relation to disease progression requires a nuanced approach that considers multiple factors. First, researchers should establish baseline expression patterns across different cell types and tissues before comparing to disease states, as TSPO shows high constitutive expression in steroidogenic tissues but variable expression in other tissues . Temporal dynamics are critical—researchers should analyze TSPO expression across multiple disease time points to distinguish between acute responses, chronic adaptations, and resolution phases. The cellular source of increased TSPO expression should be identified through co-localization studies, as upregulation in different cell types (microglia, astrocytes, infiltrating immune cells) may indicate different disease processes . Quantitative analysis must go beyond simple presence/absence determinations to measure the magnitude of expression changes, ideally using multiple complementary techniques (qPCR, Western blot, immunohistochemistry, radioligand binding). Correlation analyses should relate TSPO expression to established disease markers, clinical measures, and outcomes to determine prognostic or diagnostic value. Mechanistic experiments should determine whether TSPO upregulation is a cause or consequence of disease processes through intervention studies. Finally, researchers should adopt a systems biology perspective that considers TSPO as part of complex interaction networks rather than in isolation . The field is moving toward a more differentiated understanding of "neuroinflammation" that affects how TSPO expression changes are interpreted in disease contexts , emphasizing that TSPO changes should be considered within the broader context of disease-specific inflammatory signatures.

What statistical approaches best address variability in TSPO quantification across experimental models?

Addressing variability in TSPO quantification across experimental models requires robust statistical approaches tailored to the specific experimental design. First, researchers should conduct power analyses to determine appropriate sample sizes that can detect biologically relevant differences in TSPO levels while accounting for expected variability. Normalization strategies should be employed to reduce technical variation—normalizing TSPO measurements to housekeeping genes (for mRNA), total protein content (for protein), or reference regions (for imaging) helps control for sample-to-sample variability. Statistical test selection should be based on data distribution characteristics—parametric tests (t-tests, ANOVA) for normally distributed data and non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) when normality cannot be assumed. Multiple comparison corrections (such as Bonferroni, Holm-Sidak, or False Discovery Rate) are essential when analyzing TSPO across multiple conditions or time points. Mixed-effects models can account for both fixed factors (treatment, genotype) and random factors (individual differences, litter effects) that contribute to variability. Outlier analysis should employ consistent, statistically justified criteria for identification rather than arbitrary exclusions. Variability visualization through box plots, violin plots, or individual data points alongside means provides transparency about data distribution. Meta-analytical approaches can be valuable when comparing TSPO quantification across different studies, allowing for systematic evaluation of effects despite methodological differences. Finally, researchers should report all statistical parameters (test statistics, degrees of freedom, exact p-values) and raw data availability to enable independent verification of results.

How can researchers differentiate between TSPO changes related to neuroinflammation versus other cellular processes?

Differentiating between TSPO changes related to neuroinflammation versus other cellular processes requires multifaceted experimental approaches. First, comprehensive phenotyping of the inflammatory environment should be performed through multiplex cytokine/chemokine assays, flow cytometry of immune cells, and transcriptomic profiling of inflammatory pathways to characterize the inflammatory context in which TSPO changes occur. Temporal analysis tracking both TSPO expression and established inflammatory markers over time can reveal whether TSPO changes precede, coincide with, or follow inflammatory responses, providing insights into causal relationships. Cell-type specific analyses using techniques like single-cell RNA sequencing, flow cytometry, or immunohistochemistry with co-localization studies can determine whether TSPO changes occur specifically in inflammatory cells or in other cell populations responding to different stimuli. Pathway dissection using selective inhibitors of specific inflammatory pathways (NF-κB, JAK-STAT, MAPK) can determine which inflammatory signaling mechanisms regulate TSPO expression. Parallel assessment of non-inflammatory processes—including cellular stress, apoptosis, mitochondrial dysfunction, and metabolic changes—using appropriate markers helps identify alternative drivers of TSPO regulation. Challenge models comparing inflammatory stimuli (LPS, IL-1β, TNF-α) with non-inflammatory stressors (hypoxia, excitotoxicity, metabolic inhibition) can determine the specificity of TSPO responses. Genetic models with selective impairment of inflammatory pathways (MyD88-/-, TNFR-/-, etc.) provide further mechanistic insights. Collectively, these approaches help deconvolute the complex regulation of TSPO and address the need for a more differentiated understanding of neuroinflammation in TSPO research .

What bioinformatic tools and databases are most valuable for analyzing TSPO interaction networks?

Several bioinformatic tools and databases provide valuable resources for analyzing TSPO interaction networks. Protein-protein interaction databases like STRING, BioGRID, and IntAct contain experimentally validated and predicted TSPO interaction partners, allowing researchers to construct initial interaction networks. Pathway analysis tools including KEGG, Reactome, and WikiPathways help position TSPO within broader biological pathways related to mitochondrial function, steroid biosynthesis, and inflammatory processes. Gene Ontology (GO) enrichment tools such as DAVID, PANTHER, and g:Profiler can identify biological processes, molecular functions, and cellular components associated with TSPO and its interaction partners. Network visualization software like Cytoscape enables the construction of interactive network models with plugins such as NetworkAnalyzer providing topological analysis to identify hub proteins and key network modules. Co-expression databases including COXPRESdb and GeneFriends identify genes with expression patterns similar to TSPO across different tissues and conditions, suggesting functional relationships. Structural databases such as PDB (Protein Data Bank) contain structural information about TSPO , while molecular docking tools like AutoDock and GOLD enable in silico prediction of TSPO-ligand interactions. Tissue-specific expression databases such as GTEx and BioGPS provide context about where TSPO and its partners are expressed. Disease association databases including DisGeNET and OMIM link TSPO to various pathological conditions. Systems biology platforms like Ingenuity Pathway Analysis integrate multiple data types to build comprehensive regulatory networks. These tools collectively enable researchers to develop sophisticated models of TSPO's role within complex biological systems, addressing the need for systems biology approaches highlighted in the search results .

What emerging techniques might resolve current contradictions in TSPO functional studies?

Several emerging techniques hold promise for resolving current contradictions in TSPO functional studies. Single-cell multi-omics approaches combining transcriptomics, proteomics, and metabolomics at the single-cell level can reveal cell-type specific functions of TSPO that may be obscured in bulk tissue analyses. Spatially resolved transcriptomics and proteomics techniques maintain spatial context while profiling gene and protein expression, potentially uncovering microenvironment-dependent TSPO functions. Advanced structural biology techniques including cryo-electron microscopy and advanced NMR can determine the structure and dynamics of mammalian TSPO in the absence of ligands, a key outstanding question identified in the search results . Optogenetic and chemogenetic tools adapted for mitochondrial proteins could enable precise temporal control of TSPO function, helping to distinguish acute versus chronic effects. Genome editing with CRISPR-Cas9 can create subtle mutations or domain-specific modifications in TSPO to dissect structure-function relationships with unprecedented precision. Live-cell imaging approaches with improved spatiotemporal resolution can track TSPO's real-time interactions with partners and substrates within mitochondria. Sophisticated mitochondrial function assays with single-organelle resolution might detect subtle changes in TSPO-dependent processes. Computational systems biology approaches integrating multi-omics data can model TSPO's role within complex interaction networks . Organoid and microphysiological systems provide more physiologically relevant contexts than traditional cell culture while maintaining experimental accessibility. These emerging approaches collectively address the need to understand TSPO's ability to adapt its conformation to different environments, oligomerization states, and interaction partners .

How might advances in protein structure analysis further elucidate TSPO's molecular mechanisms?

Advances in protein structure analysis hold significant promise for elucidating TSPO's molecular mechanisms. Cryo-electron microscopy (cryo-EM) can reveal TSPO's native structure in different lipid environments and oligomerization states without the need for crystallization, potentially capturing physiologically relevant conformations. Time-resolved structural techniques, including time-resolved X-ray free-electron laser (XFEL) crystallography and time-resolved cryo-EM, could capture TSPO's dynamic structural changes during substrate binding and translocation. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) might identify regions of TSPO that undergo conformational changes upon ligand binding or protein-protein interactions. Advanced nuclear magnetic resonance (NMR) spectroscopy techniques could investigate TSPO dynamics in membrane environments, including how it adapts to different lipid compositions. Molecular dynamics simulations built on experimental structures can model TSPO's behavior over longer timescales, including potential conformational changes involved in cholesterol transport. Integrative structural biology approaches combining multiple experimental techniques can overcome limitations of individual methods. Single-molecule techniques like FRET could track conformational changes in real time at the individual protein level. Cross-linking mass spectrometry can identify interaction interfaces between TSPO and its binding partners. Native mass spectrometry might characterize TSPO oligomeric states and ligand binding stoichiometry. These advanced structural approaches directly address outstanding questions identified in the search results regarding the structure and dynamics of mammalian TSPO without ligands and how TSPO adapts its conformation to different environments, oligomerization states, and interaction partners .

How can systems biology approaches advance our understanding of TSPO in complex biological networks?

Systems biology approaches can significantly advance our understanding of TSPO in complex biological networks through several methodologies. Multi-omics integration combining transcriptomics, proteomics, metabolomics, and lipidomics data from TSPO-modulated systems can construct comprehensive molecular portraits of TSPO's impact across multiple biological layers. Network inference algorithms applied to these integrated datasets can identify direct and indirect TSPO-influenced pathways, revealing emergent properties not apparent from individual pathway analyses. Dynamic modeling using ordinary differential equations or Boolean networks can capture the temporal behavior of TSPO-associated networks under different conditions, revealing system dynamics invisible to static analyses. Perturbation biology approaches systematically perturbing network components and measuring system-wide responses can map the influence of TSPO within resilient biological networks. Bayesian network analysis can infer causal relationships between TSPO and other network components, distinguishing causation from correlation. Constraint-based modeling of metabolic networks incorporating TSPO's role can predict metabolic flux changes relevant to mitochondrial function . Module identification algorithms can discover functional modules within larger networks that are coordinated by or interact with TSPO. Multi-scale modeling linking molecular interactions to cellular and organ-level phenotypes can bridge the gap between molecular mechanisms and physiological outcomes. These approaches collectively address the future research agenda highlighted in the search results, which calls for the use of "evolving conceptual development and tools of systems biology" to better understand TSPO's complex functions .

What standardization efforts are needed to improve consistency across TSPO research studies?

Improving consistency across TSPO research studies requires comprehensive standardization efforts spanning multiple aspects of research. Reagent validation and sharing should establish repositories of validated TSPO antibodies, ligands, and genetic tools with thoroughly documented specificity and selectivity, as emphasized in the search results . Experimental protocol standardization should develop consensus protocols for key TSPO assays (binding assays, functional assays, expression analyses) with detailed methodological parameters. Reporting standards should establish minimum information guidelines for TSPO studies, ensuring critical methodological details and controls are consistently reported. Model system characterization should standardize the characterization of TSPO knockout and transgenic models, including comprehensive phenotyping and validation of TSPO deletion/expression. Terminology harmonization should develop precise definitions for key terms like "neuroinflammation," addressing concerns raised in the search results about ill-defined terminology underpinning TSPO research . Data sharing initiatives should create repositories for raw data from TSPO studies to enable meta-analyses and independent verification. Reference materials should establish certified reference standards for TSPO quantification and activity assays. Interlaboratory validation studies can identify sources of variability and establish reproducibility benchmarks. Training and education programs should disseminate best practices in TSPO research methodology. Cross-disciplinary collaboration frameworks can facilitate interaction between fields studying TSPO (neuroscience, immunology, endocrinology). These standardization efforts collectively address the call in the search results for "availability and sharing of tools and protocols for laboratory or clinical experimentation that allow independent replication" and would significantly improve the consistency, reproducibility, and translational value of TSPO research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.