Recombinant Mouse Translocon-associated protein subunit gamma (Ssr3)

Shipped with Ice Packs
In Stock

Description

Protein Translocation

Ssr3 is essential for efficient translocation of secretory proteins, including proinsulin. CRISPR/Cas9 knockout (KO) studies in 293T and INS832/13 cells demonstrated that Ssr3 deficiency reduces proinsulin biosynthesis by ~50%, highlighting its role in maintaining ER translocation efficiency .

Disease Associations

  • Diabetes: Impaired Ssr3 function disrupts preproinsulin processing, linking it to β-cell dysfunction .

  • Cancer: SSR3 overexpression correlates with paclitaxel susceptibility in breast cancer and glioblastoma, mediated via ER stress sensor IRE1α phosphorylation .

  • Congenital Disorders: Mutations in TRAP complex subunits (including Ssr3) are linked to congenital disorders of glycosylation and developmental abnormalities .

Recombinant Expression

  • Host System: Expressed in HEK293T cells for post-translational modifications .

  • Purification: Affinity chromatography using DDK/Myc tags .

Research Tools

ProductApplicationSource
Recombinant Ssr3 ProteinProtein-protein interaction assaysCreative BioMart
SSR3 siRNA (Mouse)Gene silencing in β-cell linesMyBioSource
SSR3 Antibody (30851-1-AP)Western blot, immunofluorescenceProteintech
ELISA KitsQuantitative SSR3 detection in tissuesMyBioSource

Biomedical Relevance

  • Therapeutic Targeting: SSR3’s role in paclitaxel response positions it as a predictive biomarker for chemotherapy efficacy .

  • Vascular Development: Murine studies show placental vascular defects in Ssr3-deficient models, underscoring its developmental importance .

Stability and Handling

  • Stability: Stable for 12 months at -80°C; avoid freeze-thaw cycles .

  • Activity Validation: Functional assays include proinsulin translocation efficiency and ER stress response modulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Ssr3; Translocon-associated protein subunit gamma; TRAP-gamma; Signal sequence receptor subunit gamma; SSR-gamma
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIWLYWRIWHMDLIQSAV LYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKLSEADNRKMSRKEKDER ILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPTVNYILSISASSGLIALL STGSK
Uniprot No.

Target Background

Function
TRAP proteins are components of a complex that functions to bind calcium to the ER membrane, thereby regulating the retention of ER resident proteins.
Gene References Into Functions
  1. Findings indicate that Trap-gamma is essential for vascular network formation during murine placental development. PMID: 21246656
Database Links
Protein Families
TRAP-gamma family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Mouse Translocon-associated protein subunit gamma (SSR3)?

Recombinant Mouse SSR3 is a laboratory-produced version of the native Signal Sequence Receptor gamma protein, which functions as an integral component of the translocon-associated protein (TRAP) complex in the endoplasmic reticulum (ER) membrane. The recombinant form is typically expressed in mammalian cell systems such as HEK-293 cells and purified through affinity chromatography for research applications . The full-length mouse SSR3 protein consists of 185 amino acids and can be produced with various purification tags (commonly His-tag) to facilitate isolation and downstream applications . In its native context, SSR3 plays critical roles in protein translocation across the ER membrane and contributes to ER-associated protein degradation pathways .

What is the functional significance of SSR3 in cellular processes?

SSR3 serves multiple critical functions in cellular processes:

  • Protein Translocation: As part of the TRAP complex, SSR3 facilitates the translocation of nascent proteins across the ER membrane during protein synthesis, acting as a component of the protein quality control system .

  • N-Glycosylation: SSR3 plays an essential role in N-glycosylation processes, with mutations in SSR3 causing abnormal glycosylation of marker proteins like GP130 and ICAM1 .

  • ER Stress Response: The TRAP complex, including SSR3, is dramatically upregulated during ER stress conditions (e.g., tunicamycin exposure), suggesting a protective role during cellular stress .

  • ERAD Pathway Regulation: SSR3 is linked to the ER-associated degradation (ERAD) pathway, with loss of SSR3 causing delayed clearance of ERAD substrates due to impaired binding of unfolded proteins .

  • Paclitaxel Susceptibility: Recent research has identified SSR3 as a putative biomarker for paclitaxel (PTX) susceptibility in cancer cells, where it confers susceptibility through regulation of phosphorylation of the ER stress sensor IRE1α .

Understanding these diverse functions provides insight into why SSR3 research is relevant to both basic cell biology and clinical applications.

How is the TRAP complex organized and what is SSR3's specific role?

The TRAP complex consists of four subunits (SSR1, SSR2, SSR3, and SSR4) that form a stable structure in the ER membrane. SSR3 plays a crucial structural role in maintaining TRAP complex integrity. Research using patient fibroblasts with SSR3 mutations has demonstrated that:

  • Complete loss of SSR3 protein leads to significant destabilization of the entire TRAP complex

  • Loss of SSR3 results in substantial reduction of SSR1 and SSR4 protein levels

  • Complementation with wild-type SSR3 cDNA restores the integrity of the TRAP complex

This indicates that SSR3 is not merely a functional component but also essential for structural stability of the complex. The interdependence of TRAP complex subunits is further demonstrated by the observation that expression of wild-type SSR3 in deficient cells restores the expression levels of other subunits (SSR1, SSR4) .

What expression systems yield optimal results for recombinant SSR3 production?

Mammalian expression systems, particularly HEK-293 cells, have proven most effective for producing functionally relevant recombinant mouse SSR3 protein. The advantages of this approach include:

Expression SystemAdvantagesConsiderationsTypical Yield
HEK-293 Cells- Native-like post-translational modifications
- Proper protein folding
- Formation of disulfide bonds
- Higher likelihood of correct oligomerization
- More expensive than bacterial systems
- Longer production time
- Requires specialized culture conditions
>90% purity achievable with optimized protocols
Bacterial Systems- Higher yield
- Lower cost
- Faster production
- Lack of post-translational modifications
- Potential improper folding
- Inclusion body formation common
Not recommended for functional studies of SSR3
Insect Cell Systems- Intermediate between bacterial and mammalian
- Some post-translational modifications
- Less complete glycosylation patterns
- May not fully recapitulate mammalian modifications
Alternative to HEK-293 if cost is limiting factor

For SSR3 specifically, expression as a secreted protein in mammalian cells with subsequent purification from serum-free conditioned medium has proven effective for generating functional protein . This approach yields recombinant protein capable of forming the characteristic high molecular weight, disulfide cross-linked oligomers observed in the native protein .

What purification strategies maximize the yield and activity of recombinant SSR3?

A systematic purification approach for recombinant SSR3 typically involves:

  • Expression Optimization:

    • Transfection of HEK-293 cells with a plasmid containing the SSR3 cDNA sequence

    • Culture in serum-free medium to simplify downstream purification

    • Harvest of conditioned medium containing secreted recombinant protein

  • One-Step Affinity Chromatography:

    • Utilizing His-tag or other affinity tags fused to the recombinant protein

    • Binding to appropriate affinity resin

    • Washing to remove contaminants

    • Elution under conditions that preserve protein activity

  • Quality Assessment:

    • Bis-Tris PAGE under reducing and non-reducing conditions to assess oligomerization

    • Western blot analysis for identity confirmation

    • Analytical SEC (HPLC) for homogeneity determination

    • Anti-tag ELISA for quantification

This approach typically yields recombinant SSR3 with >90% purity as determined by multiple analytical methods . The purified protein should be assessed for its ability to form the characteristic high molecular weight oligomers (six or more monomers) under non-reducing conditions, which is a hallmark of native SSR3 function .

How can researchers confirm the structural integrity of purified recombinant SSR3?

Confirming structural integrity of recombinant SSR3 requires multiple analytical approaches:

  • Molecular Weight Analysis:

    • Under reducing conditions: should exhibit molecular weight similar to native SSR3

    • Under non-reducing conditions: should form high molecular weight disulfide cross-linked oligomers consisting of six or more monomers

  • Functional Binding Assays:

    • If studying SSR3's role in cellular contexts analogous to fertilization biology, binding assays can be developed based on the methodology used for ZP3R/sp56 (another protein expressed in similar systems)

    • Validation that the recombinant protein binds to appropriate cellular targets or binding partners

  • Structural Validation:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to confirm proper folding

    • Native PAGE to evaluate oligomeric state

  • Glycosylation Analysis:

    • Given SSR3's role in glycosylation, analysis of the glycosylation state of the recombinant protein itself can provide insight into proper folding and processing

Successful validation should demonstrate that the recombinant SSR3 possesses similar structural characteristics to the native protein, particularly with respect to oligomerization behavior and binding specificity.

How can recombinant SSR3 be used to investigate its role in paclitaxel susceptibility?

Recent research has identified SSR3 as a putative biomarker for paclitaxel (PTX) susceptibility in cancer cells . Researchers can investigate this relationship using the following experimental approaches:

  • Correlation Analysis:

    • Measure SSR3 protein levels across a panel of cancer cell lines using recombinant SSR3 as a standard

    • Determine IC50 values for PTX in these cell lines

    • Perform correlation analysis between SSR3 expression and PTX sensitivity

  • Gain/Loss of Function Studies:

    • Use recombinant SSR3 to rescue knockout cell lines

    • Compare PTX sensitivity in:

      • Wild-type cells

      • SSR3 knockout cells

      • SSR3 knockout cells complemented with recombinant SSR3

      • SSR3 overexpression cells

  • Mechanistic Investigation:

    • Examine the effect of recombinant SSR3 on IRE1α phosphorylation

    • Analyze downstream signaling pathways using phospho-specific antibodies

    • Perform co-immunoprecipitation studies to identify interaction partners

A comprehensive experimental design should include appropriate controls and multiple cancer cell types (e.g., breast cancer and glioma cells) to validate the consistency of findings across different cancer types .

What experimental designs are effective for investigating SSR3's role in congenital disorders of glycosylation?

To investigate SSR3's role in congenital disorders of glycosylation (CDG), researchers can implement the following experimental design:

  • Patient Fibroblast Analysis:

    • Obtain fibroblasts from patients with suspected SSR3 mutations

    • Compare TRAP complex stability and SSR3 expression levels with control fibroblasts

    • Assess glycosylation status of marker proteins (GP130, ICAM1)

  • Complementation Studies:

    • Transfect patient fibroblasts with wild-type SSR3 cDNA

    • Evaluate restoration of:

      • SSR3 protein expression

      • TRAP complex integrity (SSR1 and SSR4 levels)

      • Normal glycosylation of marker proteins

  • Glycosylation Profiling:

    • Perform comprehensive glycan analysis using mass spectrometry

    • Compare glycan profiles between:

      • Control cells

      • Patient cells

      • Patient cells complemented with recombinant SSR3

  • Functional Assessment of N-glycosylation:

    • Evaluate the effect of SSR3 deficiency on specific glycoproteins

    • Monitor protein stability, trafficking, and function in the presence or absence of functional SSR3

This experimental approach provides both mechanistic insights and validation of SSR3's causal role in glycosylation disorders .

How can researchers design experiments to study the role of SSR3 in the ER stress response?

To investigate SSR3's role in ER stress responses, researchers can design experiments using these methodological approaches:

  • Stress Induction and Expression Analysis:

    • Treat cells with ER stressors (e.g., tunicamycin)

    • Monitor temporal changes in SSR3 expression (mRNA and protein)

    • Compare with expression changes in other TRAP subunits

  • ERAD Substrate Clearance Assays:

    • Express known ERAD substrates in control and SSR3-deficient cells

    • Monitor substrate half-life using pulse-chase analysis

    • Compare clearance kinetics with and without ER stress induction

  • Binding Assays with Recombinant SSR3:

    • Use purified recombinant SSR3 to perform binding assays with unfolded proteins

    • Identify specific binding partners through pull-down experiments

    • Characterize binding affinities and specificity

  • IRE1α Phosphorylation Studies:

    • Examine the impact of SSR3 expression levels on IRE1α phosphorylation

    • Use recombinant SSR3 to rescue defects in SSR3-deficient cells

    • Map the domains of SSR3 required for this function

These experimental approaches provide complementary data on SSR3's functional role in ER stress responses and ERAD pathways, with implications for both normal cellular homeostasis and disease states.

What molecular mechanisms underlie SSR3's role in determining paclitaxel sensitivity?

The molecular basis of SSR3's role in paclitaxel (PTX) sensitivity involves several interconnected mechanisms:

  • IRE1α Phosphorylation Regulation:

    • SSR3 regulates the phosphorylation state of IRE1α, an ER stress sensor

    • This phosphorylation modulates cellular responses to PTX-induced stress

    • Cells with higher SSR3 levels show enhanced IRE1α phosphorylation and increased PTX sensitivity

  • Cancer Type-Specific Effects:

    • SSR3's role in PTX sensitivity has been observed in:

      • Breast cancer cells

      • Glioma cells

      • Intracranial glioma xenograft models

    • This suggests a conserved mechanism across multiple cancer types

  • Experimental Validation:

    • SSR3 knockout renders cells resistant to PTX

    • SSR3 overexpression sensitizes cells to PTX

    • These effects correlate with changes in IRE1α phosphorylation status

To investigate these mechanisms, researchers should employ a combination of:

  • Phospho-proteomics to identify changes in IRE1α and downstream effectors

  • Cell survival assays to quantify PTX sensitivity

  • Molecular biology techniques to manipulate SSR3 levels and IRE1α activity

A comprehensive understanding of this pathway could lead to the development of SSR3 as a clinical biomarker for predicting PTX response in cancer patients .

How does the stability of the TRAP complex depend on SSR3, and what methodological approaches can reveal this relationship?

The TRAP complex stability is critically dependent on SSR3, as revealed through several methodological approaches:

  • Comparative Protein Expression Analysis:
    Studies of patient fibroblasts harboring SSR3 mutations (e.g., c.278_281delAGGA [p.Glu93Valfs*7]) demonstrate:

    • Complete loss of SSR3 protein

    • Substantial reduction in SSR1 and SSR4 protein levels

    • Destabilization of the entire TRAP complex

  • Complementation Studies:
    Transfection of patient fibroblasts with wild-type SSR3 cDNA results in:

    • Restoration of SSR3 protein expression

    • Recovery of SSR1 and SSR4 protein levels

    • Reestablishment of TRAP complex integrity

  • Protein-Protein Interaction Analysis:

    MethodApplicationInsights Gained
    Co-immunoprecipitationPull-down of TRAP complex componentsIdentify direct interaction partners of SSR3
    Blue Native PAGEAnalysis of intact TRAP complexDetermine complex size and composition
    Crosslinking Mass SpectrometryMapping of interaction interfacesReveal structural organization of the complex
    FRET/BRETLive-cell analysis of protein interactionsDynamic assembly/disassembly of the complex
  • Structural Analysis:

    • Cryo-EM of the intact TRAP complex with and without SSR3

    • Hydrogen-deuterium exchange mass spectrometry to identify stabilizing interfaces

    • Molecular dynamics simulations to predict structural consequences of SSR3 loss

These methodological approaches collectively demonstrate that SSR3 functions not merely as a functional component but as a critical structural element that maintains the integrity of the entire TRAP complex .

What analytical approaches can resolve the contradictory data surrounding SSR3 function in different cell types?

Resolving contradictory data regarding SSR3 function across different cell types requires systematic analytical approaches:

  • Cell Type-Specific Expression Profiling:

    • Quantify SSR3 and other TRAP components across cell types

    • Identify cell-specific interaction partners through proteomics

    • Compare subcellular localization patterns using immunofluorescence

  • Genetic Background Analysis:

    • Perform SSR3 knockout/knockdown in multiple cell lines

    • Use isogenic cell lines to control for genetic background

    • Apply statistical methods like ANOVA with appropriate post-hoc tests to analyze experimental design factors

  • Context-Dependent Function Assessment:

    ContextFunctional ReadoutStatistical Analysis
    Cancer cellsPTX sensitivity (IC50)Regression analysis with r² coefficient of determination
    FibroblastsGlycosylation of marker proteinsWestern blot quantification with loading controls
    Xenograft modelsTumor response to PTXSurvival analysis (Kaplan-Meier)
    ER stress conditionsERAD substrate clearanceHalf-life determination
  • Integrated Multi-omics Approach:

    • Combine transcriptomics, proteomics, and glycomics data

    • Apply principal component analysis to identify cell-type clustering

    • Use pathway enrichment analysis to identify context-specific signaling networks

  • Experimental Design Considerations:

    • Employ factorial experimental designs to test multiple variables

    • Calculate statistical power to ensure adequate sample sizes

    • Use goodness of fit measures to evaluate models (coefficient of determination)

This systematic approach helps identify whether differences in SSR3 function represent true biological differences or methodological artifacts, leading to a more unified understanding of SSR3 biology.

What are common challenges in expressing recombinant SSR3 and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant SSR3:

  • Protein Solubility Issues:

    • Challenge: As a transmembrane protein, SSR3 contains hydrophobic regions that may cause aggregation.

    • Solution: Express SSR3 as a secreted protein in mammalian cells (HEK-293) by removing transmembrane domains or using fusion partners that enhance solubility .

  • Oligomerization Difficulties:

    • Challenge: Native SSR3 forms high molecular weight, disulfide cross-linked oligomers that may not form correctly in recombinant systems.

    • Solution: Ensure proper disulfide bond formation by optimizing oxidizing conditions during expression and purification; verify oligomerization status using non-reducing SDS-PAGE .

  • Expression Level Variability:

    • Challenge: Inconsistent expression levels between batches.

    • Solution: Develop stable cell lines rather than relying on transient transfection; optimize codon usage for mammalian expression; use serum-free media formulations specifically designed for recombinant protein production .

  • Purification Challenges:

    ChallengeSolutionVerification Method
    Co-purification of contaminantsOne-step affinity chromatography followed by size exclusionBis-Tris PAGE, >90% purity
    Protein degradationAdd protease inhibitors; purify at 4°CWestern blot for intact protein
    Loss of activityAvoid harsh elution conditionsFunctional binding assays
    Tag interferenceCompare tagged vs. tag-cleaved proteinActivity assays with both forms
  • Functional Validation Concerns:

    • Challenge: Confirming that recombinant SSR3 retains native functionality.

    • Solution: Develop functional assays based on known SSR3 activities, such as complementation of SSR3-deficient cells or binding to interaction partners .

Addressing these challenges through systematic optimization will yield recombinant SSR3 with consistent quality suitable for downstream research applications.

What controls are essential when investigating SSR3's role in N-glycosylation and ER stress pathways?

When investigating SSR3's role in N-glycosylation and ER stress pathways, these essential controls ensure experimental validity:

  • Positive Controls for N-glycosylation Studies:

    • Tunicamycin treatment (inhibits N-glycosylation) as a positive control for glycosylation defects

    • Analysis of known glycoproteins (GP130, ICAM1) as established markers of N-glycosylation status

    • Inclusion of samples from patients with confirmed glycosylation disorders

  • Genetic Complementation Controls:

    • SSR3-deficient cells (knockout or patient-derived)

    • SSR3-deficient cells complemented with wild-type SSR3

    • SSR3-deficient cells complemented with mutant SSR3 (functional null)

  • Specificity Controls for TRAP Complex Function:

    • Analysis of other TRAP complex components (SSR1, SSR2, SSR4)

    • Comparison with deficiencies in other ER translocation machinery

    • Analysis of specific vs. global effects on glycoprotein processing

  • Technical Controls for Protein Analysis:

    • Loading controls for Western blot quantification

    • Multiple reference genes for qRT-PCR

    • Inclusion of molecular weight markers spanning expected oligomer sizes

  • Statistical Analysis Considerations:

    • Appropriate sample sizes based on power analysis

    • Analysis of variance (ANOVA) for experimental designs with multiple factors

    • Calculation of coefficient of determination (r²) for regression analyses

How can researchers reconcile in vitro findings about SSR3 with in vivo physiological relevance?

Bridging the gap between in vitro observations and in vivo relevance of SSR3 requires methodological approaches that address translation challenges:

  • Model System Selection and Validation:

    • Compare findings across multiple cell types (e.g., cancer cells, fibroblasts)

    • Validate in primary cells derived from relevant tissues

    • Develop and characterize SSR3 knockout mouse models

  • Physiological Context Considerations:

    ContextIn Vitro ApproachIn Vivo Validation
    CancerCell line PTX sensitivity Xenograft models with controlled SSR3 expression
    CDGPatient fibroblast studies Tissue-specific analyses from patient biopsies
    ER stressTunicamycin-induced stressPhysiological stress models (e.g., high-fat diet)
  • Translation to Clinical Relevance:

    • Correlate SSR3 levels in patient samples with clinical outcomes

    • Prospectively validate SSR3 as a biomarker for PTX response

    • Develop SSR3-based diagnostic tests for CDG subtypes

  • Addressing Contradictions Through Integrated Analysis:

    • Use statistical approaches from experimental design theory

    • Apply goodness of fit analyses to determine which models best explain observations

    • Calculate coefficients of determination (r²) to quantify explanatory power

  • Mechanistic Validation Across Systems:

    • Confirm molecular mechanisms (e.g., IRE1α phosphorylation) in multiple systems

    • Identify conserved vs. context-specific signaling pathways

    • Develop pharmacological approaches to modulate SSR3 function in vivo

This systematic approach to translational validation ensures that findings about SSR3 function are physiologically relevant and potentially applicable to clinical contexts, such as using SSR3 as a predictive biomarker for paclitaxel response in cancer patients or as a diagnostic marker for specific congenital disorders of glycosylation .

What are the most promising future research directions for SSR3?

Based on current knowledge, several high-priority research directions for SSR3 show particular promise:

  • Clinical Biomarker Development:

    • Prospective validation of SSR3 as a predictive biomarker for paclitaxel response in cancer patients

    • Development of standardized assays to measure SSR3 levels in patient samples

    • Integration of SSR3 testing into precision medicine approaches for cancer treatment

  • Structural Biology of the TRAP Complex:

    • Determination of high-resolution structures of the complete TRAP complex

    • Mapping of interaction interfaces between SSR3 and other components

    • Structure-guided development of tools to modulate TRAP complex function

  • Expanded Role in Disease Pathogenesis:

    • Investigation of SSR3's role in additional disorders beyond CDG and cancer

    • Exploration of potential connections to neurodegenerative diseases with ER stress components

    • Examination of SSR3 polymorphisms and their association with disease susceptibility

  • Therapeutic Target Exploration:

    • Assessment of SSR3 as a potential therapeutic target in cancer

    • Development of approaches to modulate SSR3 function in glycosylation disorders

    • Creation of small molecule tools to manipulate TRAP complex assembly/function

These research directions build upon current knowledge of SSR3 while extending its potential impact into translational and clinical domains, particularly in cancer treatment response prediction and congenital disorders of glycosylation diagnosis and management .

What methodological advances would accelerate progress in SSR3 research?

Several methodological advances would significantly accelerate SSR3 research:

  • Advanced Structural Biology Techniques:

    • Cryo-EM analysis of intact TRAP complex with SSR3

    • Hydrogen-deuterium exchange mass spectrometry to map dynamic interactions

    • Integrative structural biology combining multiple techniques for complete model

  • Improved Cellular and Animal Models:

    • CRISPR-engineered isogenic cell lines with SSR3 mutations

    • Conditional/inducible SSR3 knockout mouse models for tissue-specific studies

    • Patient-derived organoids to study SSR3 function in disease-relevant contexts

  • High-Throughput Screening Platforms:

    • Development of assays to screen for modulators of SSR3 function

    • Glycosylation reporter systems for real-time monitoring in living cells

    • TRAP complex assembly/disassembly sensors for dynamic studies

  • Integrative Multi-omics Approaches:

    • Combined analysis of transcriptomics, proteomics, and glycomics data

    • Development of computational methods to integrate diverse data types

    • Machine learning approaches to identify patterns across experimental contexts

  • Standardized Experimental Design and Reporting:

    • Application of rigorous statistical approaches from experimental design theory

    • Standardization of methods for measuring SSR3 levels and activity

    • Development of reference standards for recombinant SSR3 protein

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.