Recombinant Mouse Transmembrane 4 L6 family member 1 (Tm4sf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Tm4sf1; M3s1; Transmembrane 4 L6 family member 1; Membrane component chromosome 3 surface marker 1 homolog; Tumor-associated antigen L6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MCYVKCARYIGYSLVWAAVFCIVANALLYFPNGETKYATEDHLSRFVWYFAGIVGGGLLM LLPAFVFIGMDEEDCCGCCGYENYGKRCSMLSSVLAALIGIVGSAYCVIVASLGLAEGPK CSDAHGVWNYTFASTEGQYLLNSSMWSKCYEPKHIVEWHVTLFSILLAFAAVEFILCLIQ VINGMLGGLCGYCCSRQQQYNC
Uniprot No.

Target Background

Gene References Into Functions
  1. TAL6 may play a role in cancer invasion and metastasis. PMID: 12855661
Database Links

KEGG: mmu:17112

STRING: 10090.ENSMUSP00000029376

UniGene: Mm.856

Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in skin and lung. Moderately expressed in lymph nodes and kidneys. Also present in thymic stroma and fibroblasts.

Q&A

What is the basic structure of mouse Tm4sf1?

Mouse Tm4sf1 is the founding member of the tetraspanin-related L6 family characterized by four transmembrane domains, two extracellular loops, and a small intracellular loop . The protein forms TM4SF1-enriched domains (TMEDs) in cell membranes that serve as organizational centers for various cellular processes. The mouse protein shares significant homology with human TM4SF1, which has a 696 bp open reading frame (ORF) . The protein structure enables its function in cell membrane organization and signaling complex formation.

What cellular processes is mouse Tm4sf1 involved in?

Mouse Tm4sf1 plays critical roles in multiple cellular processes including cell proliferation, adhesion, and motility . It functions as a molecular organizer in the formation of nanopodia (thin cellular protrusions) and is involved in the stabilization of cell signaling complexes . In endothelial cells, Tm4sf1 contributes to angiogenesis by forming regularly spaced, banded patterns that anchor nanopodia to regulate cell movement . Its expression pattern and functional role make it significant in both normal development and pathological conditions, particularly in cancer progression mechanisms.

How does mouse Tm4sf1 expression vary across tissues?

Mouse Tm4sf1 shows differential expression across various tissues, with notably elevated expression in epithelial and endothelial cells. Similar to its human counterpart, mouse Tm4sf1 appears to be upregulated in vascular endothelial cells during angiogenesis . In epithelial tissues, expression levels vary depending on developmental stage and physiological conditions. Research methodologies for studying tissue-specific expression include immunohistochemistry, qPCR, and RNA-seq analysis, with antibodies specific to mouse Tm4sf1 being essential for accurate detection across different tissue types.

What are the optimal methods for expressing recombinant mouse Tm4sf1?

For recombinant expression of mouse Tm4sf1, mammalian expression systems are generally preferred over bacterial systems due to the protein's multiple transmembrane domains and potential post-translational modifications. The pCMV6-based vectors (similar to those used for human TM4SF1) with appropriate tags for detection and purification are commonly employed . For optimal expression:

  • Use expression-ready ORF plasmids with C-terminal tags (such as Myc-DDK)

  • Transfect mammalian cell lines (HEK293, CHO cells) using lipid-based transfection reagents

  • Select stable transfectants using neomycin (G418) at approximately 500-800 μg/mL

  • Verify expression using tag-specific antibodies or Tm4sf1-specific antibodies

For functional studies, ensure the tags do not interfere with protein folding or localization by comparing the behavior of tagged and untagged versions when possible.

How can researchers effectively detect and quantify mouse Tm4sf1 in experimental samples?

Detection and quantification of mouse Tm4sf1 can be accomplished through multiple complementary methods:

  • Western Blotting:

    • Use specialized membrane protein extraction buffers containing non-ionic detergents

    • Run on SDS-PAGE under conditions that minimize protein aggregation

    • Transfer to PVDF membranes (preferred over nitrocellulose for transmembrane proteins)

    • Detect using specific anti-Tm4sf1 antibodies or tag antibodies for recombinant protein

  • qPCR:

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Normalize to multiple housekeeping genes for accurate quantification

    • Typical primer sets should target conserved regions within the coding sequence

  • Immunohistochemistry/Immunofluorescence:

    • Optimize fixation protocols (4% paraformaldehyde generally works well)

    • Use antigen retrieval methods appropriate for membrane proteins

    • Counter-stain with membrane markers to confirm localization

  • Flow Cytometry:

    • Use non-enzymatic dissociation methods to preserve surface epitopes

    • Include membrane permeabilization steps if detecting intracellular domains

What are the best experimental models for studying mouse Tm4sf1 function?

Several experimental models are suitable for studying mouse Tm4sf1 function:

  • Cell Culture Models:

    • Mouse colorectal cancer cell lines (similar to human CRC lines like SW480 and LoVo)

    • Mouse endothelial cells for studying angiogenesis-related functions

    • Primary epithelial cells from various tissues

  • Genetic Models:

    • Tm4sf1 knockout mice (global or conditional) using CRISPR/Cas9 technology

    • Transgenic mice with tissue-specific overexpression

    • Knockdown models using shRNA or siRNA approaches

  • Ex Vivo Models:

    • Organoid cultures from mouse intestinal or other epithelial tissues

    • Explant cultures for studying tissue-specific functions

  • In Vivo Models:

    • Xenograft models using Tm4sf1-modulated mouse cancer cells

    • Metastasis models through tail vein injection or orthotopic implantation

    • Wound healing models for studying endothelial function

Selection of the appropriate model depends on the specific aspect of Tm4sf1 function being investigated.

How does mouse Tm4sf1 contribute to epithelial-to-mesenchymal transition (EMT)?

Mouse Tm4sf1, like its human counterpart, plays a significant role in epithelial-to-mesenchymal transition, a critical process in cancer progression. Studies suggest several mechanisms by which Tm4sf1 facilitates EMT:

  • Modulation of TGF-β1 signaling - Tm4sf1 silencing inhibits TGF-β1-mediated EMT

  • Regulation of cytoskeletal reorganization through its interaction with membrane complexes

  • Influence on cell adhesion molecules and extracellular matrix interactions

Methodologically, researchers can study Tm4sf1's role in EMT through:

  • Wound healing assays to assess cell migration capabilities

  • Transwell invasion assays to measure invasive potential

  • Analysis of EMT markers (E-cadherin, N-cadherin, vimentin) following Tm4sf1 modulation

  • Real-time monitoring of cell morphology changes using time-lapse microscopy

These approaches can reveal how Tm4sf1 influences the transition from epithelial to mesenchymal phenotype in development and disease.

What is the role of mouse Tm4sf1 in the Wnt/β-catenin signaling pathway?

Mouse Tm4sf1 appears to be intricately involved in the Wnt/β-catenin signaling pathway, similar to findings with human TM4SF1. Gene set enrichment analysis (GSEA) has identified the Wnt signaling pathway as significantly impaired in TM4SF1-deficient cancer cells . The relationship between Tm4sf1 and Wnt/β-catenin signaling involves:

  • Regulation of β-catenin activation and nuclear translocation

  • Modulation of downstream targets including c-Myc

  • Control of SOX2 expression in a Wnt/β-catenin-dependent manner

Researchers investigating this interaction should employ:

  • TOP/FOP flash reporter assays to measure canonical Wnt signaling activity

  • Co-immunoprecipitation studies to identify physical interactions between Tm4sf1 and Wnt pathway components

  • Chromatin immunoprecipitation (ChIP) assays to assess c-Myc binding to the SOX2 promoter following Tm4sf1 manipulation

  • Western blotting to monitor phosphorylation status of key Wnt pathway proteins

These methodologies can elucidate the molecular mechanisms by which Tm4sf1 influences this critical developmental and oncogenic pathway.

How does mouse Tm4sf1 regulate cancer stemness?

Mouse Tm4sf1 appears to play a crucial role in maintaining cancer stem cell (CSC) properties, which contribute to tumor recurrence, metastasis, and therapy resistance. The mechanisms by which Tm4sf1 regulates stemness include:

  • Activation of the Wnt/β-catenin/c-Myc/SOX2 axis

  • Enhancement of self-renewal capacity

  • Promotion of sphere-forming ability in cancer cells

To experimentally investigate Tm4sf1's role in cancer stemness, researchers should:

  • Perform tumorsphere formation assays following Tm4sf1 knockdown or overexpression

  • Analyze expression of stemness markers (SOX2, OCT4, NANOG) using qPCR and Western blotting

  • Conduct limiting dilution assays to assess tumor-initiating capacity in vivo

  • Use flow cytometry to quantify stem cell marker expression

  • Assess drug resistance profiles in cells with modulated Tm4sf1 levels

These approaches can reveal how Tm4sf1 contributes to maintaining the stem-like properties of cancer cells, potentially identifying new therapeutic vulnerabilities.

How is mouse Tm4sf1 involved in colorectal cancer progression?

Mouse Tm4sf1, like human TM4SF1, appears to be significantly involved in colorectal cancer (CRC) progression through multiple mechanisms. Studies suggest that Tm4sf1:

  • Promotes CRC cell migration and invasion through EMT enhancement

  • Maintains cancer stem cell properties via the Wnt/β-catenin/c-Myc/SOX2 signaling axis

  • Correlates with more aggressive disease features and poorer prognosis when overexpressed

Research approaches to study Tm4sf1 in mouse models of CRC include:

  • Xenograft studies using CRC cells with modulated Tm4sf1 expression

  • Orthotopic implantation models to assess local invasion

  • Metastasis models using tail vein injection or splenic injection (for liver metastasis)

  • Genetic mouse models with intestine-specific Tm4sf1 alterations

  • Analysis of patient-derived xenografts in immunocompromised mice

These models can provide valuable insights into how Tm4sf1 contributes to CRC progression and potentially identify new therapeutic strategies.

Can mouse Tm4sf1 serve as a therapeutic target in cancer research?

Mouse Tm4sf1 represents a potential therapeutic target in cancer research based on several promising characteristics:

  • Its overexpression in multiple cancer types compared to normal tissues

  • Its accessible location on the cell surface with extracellular domains

  • Its roles in critical processes like EMT, stemness, and metastasis

Therapeutic approaches being explored include:

  • Monoclonal antibodies targeting the extracellular loops (particularly EL2)

  • Small molecule inhibitors disrupting Tm4sf1 interactions or signaling

  • Gene silencing approaches using siRNA or shRNA

  • CRISPR-based gene editing strategies

To evaluate potential therapeutic efficacy, researchers should:

  • Assess effects of Tm4sf1 targeting on cancer cell viability, migration, and invasion

  • Determine whether Tm4sf1 inhibition sensitizes cancer cells to conventional therapies

  • Evaluate toxicity profiles in normal cells and tissues

  • Conduct preclinical studies in appropriate mouse models

The development of Tm4sf1-targeted therapies could potentially address the significant clinical challenges of metastasis and therapy resistance in cancer.

How can CRISPR/Cas9 be optimized for studying mouse Tm4sf1?

CRISPR/Cas9 technology offers powerful approaches for studying mouse Tm4sf1 function, but requires optimization for this specific transmembrane protein:

  • Guide RNA Design:

    • Select target sequences with minimal off-target effects

    • Avoid transmembrane domains that may have structural constraints

    • Design multiple gRNAs targeting different exons for redundancy

    • Consider using paired nickase approaches for increased specificity

  • Delivery Methods:

    • For cell lines: Lipid-based transfection or lentiviral transduction

    • For primary cells: Nucleofection or adenoviral delivery

    • For in vivo: AAV delivery or direct electroporation depending on target tissue

  • Verification Strategies:

    • Design PCR primers flanking the targeted region

    • Use T7 endonuclease assay or Surveyor assay for initial screening

    • Confirm mutations by Sanger sequencing

    • Verify protein loss by Western blotting or immunostaining

  • Functional Validation:

    • Perform rescue experiments with wild-type Tm4sf1 to confirm phenotype specificity

    • Generate domain-specific mutations to assess structure-function relationships

    • Create conditional knockouts to study tissue-specific effects

This methodological approach enables precise genetic manipulation of Tm4sf1 for detailed functional studies.

What single-cell techniques are most informative for studying Tm4sf1 in heterogeneous tissues?

Single-cell technologies offer unique insights into Tm4sf1 expression and function within heterogeneous tissues:

  • Single-cell RNA sequencing (scRNA-seq):

    • Reveals cell-type specific expression patterns

    • Identifies co-expression networks associated with Tm4sf1

    • Sample preparation protocols should be optimized to preserve membrane protein transcripts

    • Analysis should incorporate trajectory inference to capture dynamic expression changes

  • Single-cell Proteomics:

    • Mass cytometry (CyTOF) with Tm4sf1-specific antibodies

    • Imaging mass cytometry for spatial context

    • Single-cell Western blotting for protein quantification

    • Multiplexed ion beam imaging (MIBI) for ultrastructural localization

  • Spatial Transcriptomics:

    • Visium or slide-seq approaches to map Tm4sf1 expression with spatial context

    • MERFISH or seqFISH for subcellular localization

    • Integration with histological features for structure-function correlations

  • Functional Single-cell Assays:

    • Patch-seq for correlating electrophysiology with Tm4sf1 expression

    • Live-cell imaging with fluorescently tagged Tm4sf1 to track dynamics

These approaches can reveal heterogeneity in Tm4sf1 expression and function across different cell populations within complex tissues, particularly in cancer and developmental contexts.

How can researchers investigate the interactome of mouse Tm4sf1?

Understanding the protein-protein interaction network (interactome) of mouse Tm4sf1 is crucial for elucidating its functions. Several complementary approaches can be employed:

  • Proximity Labeling Techniques:

    • BioID: Fusion of Tm4sf1 with a biotin ligase to biotinylate proximal proteins

    • APEX2: Fusion with an engineered ascorbate peroxidase for proximity-dependent labeling

    • Split-BioID or split-APEX2 for detecting conditional interactions

    • Optimization required for transmembrane protein orientation

  • Co-immunoprecipitation (Co-IP) and Pull-down Assays:

    • Use detergent conditions optimized for membrane proteins (e.g., digitonin, CHAPS)

    • Consider crosslinking approaches to capture transient interactions

    • Employ both N- and C-terminal tags to account for topology constraints

    • Use mass spectrometry for unbiased identification of binding partners

  • Membrane-specific Interaction Methods:

    • Membrane yeast two-hybrid (MYTH) system

    • Mammalian membrane two-hybrid assays

    • Fluorescence resonance energy transfer (FRET) for direct interaction studies

    • Bimolecular fluorescence complementation (BiFC) for visualization of interactions

  • Computational Approaches:

    • Protein-protein interaction prediction algorithms

    • Network analysis of transcriptomic data

    • Molecular modeling of transmembrane domain interactions

    • Integration of interactome data with signaling pathway databases

These methodologies can reveal how Tm4sf1 participates in signaling complexes and identify novel interaction partners that may represent additional therapeutic targets or biomarkers.

How do mouse models of Tm4sf1 compare with human studies?

Comparative analysis between mouse Tm4sf1 and human TM4SF1 models reveals important similarities and differences that impact translational research:

  • Sequence Homology and Structural Comparison:

    • Mouse and human proteins share approximately 76% amino acid identity

    • The transmembrane domains and certain functional motifs are highly conserved

    • Extracellular loops show more variation, potentially affecting antibody cross-reactivity

    • Post-translational modification sites may differ between species

  • Expression Pattern Similarities:

    • Both species show upregulation in cancer tissues compared to normal counterparts

    • Similar expression patterns in endothelial cells during angiogenesis

    • Comparable association with poor prognosis in cancer contexts

  • Functional Conservation:

    • Similar roles in EMT and cancer stemness regulation

    • Conserved involvement in the Wnt/β-catenin signaling pathway

    • Comparable effects on cell migration and invasion

  • Methodological Considerations for Translational Research:

    • Mouse antibodies may not cross-react with human TM4SF1 and vice versa

    • Pathway inhibitors may have species-specific efficacy

    • Genetic background effects in mouse models should be considered

Understanding these similarities and differences is essential for appropriately interpreting mouse studies and translating findings to human applications.

What are the most promising biomarker applications for Tm4sf1 in preclinical models?

Tm4sf1 shows significant potential as a biomarker in preclinical cancer models, with several promising applications:

  • Prognostic Biomarker:

    • High Tm4sf1 expression correlates with poor prognosis in multiple cancer types

    • Expression levels may predict metastatic potential

    • Quantification methods include qPCR, IHC scoring systems, and digital pathology algorithms

  • Predictive Biomarker:

    • Tm4sf1 levels may predict response to therapies targeting:

      • Wnt/β-catenin pathway inhibitors

      • Cancer stem cell-directed therapies

      • EMT inhibitors

    • Validation approaches include correlation of baseline expression with treatment outcomes

  • Pharmacodynamic Biomarker:

    • Changes in Tm4sf1 expression following treatment may indicate target engagement

    • Real-time monitoring using reporter systems can track therapy response

    • Liquid biopsy detection of circulating tumor cells expressing Tm4sf1

  • Imaging Biomarker:

    • Labeled antibodies against extracellular domains for in vivo imaging

    • PET tracers for non-invasive monitoring of Tm4sf1-expressing tumors

    • Optimization parameters include antibody specificity, background signal, and kinetics

These biomarker applications could facilitate preclinical development of targeted therapies and inform the design of future clinical trials.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.