Recombinant Mouse Transmembrane 4 L6 family member 20 (Tm4sf20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for precise delivery estimates.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice packaging, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us and we will prioritize its implementation.
Synonyms
Tm4sf20; Transmembrane 4 L6 family member 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tm4sf20
Target Protein Sequence
MTCCEGWTSCNGFSLLILILLGVVINCIPLGISLVEADSTSQNPISCYEWWFPGIIGAGL MAIPATTMSLAARKRACCNNKTGMFLSSLFSVITVVGAVYCMLVSLQALLEGPLICNTQA NSTVTCEFSLKNLSKFDPESFNLLWFFNGTCVSPTDFKNPTINNMVSNWKIPNSNSEEDR HRIFHFSVFMSLLLVGILELLFGLSQILIGFLGCLCGVSQRRSQIV
Uniprot No.

Target Background

Function
TM4SF20 is a polytopic transmembrane protein that plays a role in inhibiting the regulated intramembrane proteolysis (RIP) of CREB3L1. This inhibition prevents CREB3L1 activation and subsequent collagen synthesis induction. TM4SF20 is responsive to ceramide, which alters its membrane topology and stimulates RIP activation of CREB3L1. Ceramide reverses the direction of transmembrane helix translocation into the endoplasmic reticulum membrane during TM4SF20 translation, a process known as 'regulated alternative translocation' (RAT). This mechanism regulates the function of the transmembrane protein.
Database Links
Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of mouse Tm4sf20?

Mouse Tm4sf20 is a polytopic transmembrane protein belonging to the 4-transmembrane L6 superfamily. The protein contains four transmembrane domains and functions as a surface protein that interacts with integrins to mediate cellular processes . Its primary function involves inhibiting regulated intramembrane proteolysis (RIP) of CREB3L1, thereby inhibiting its activation and the subsequent induction of collagen synthesis . The wild-type protein localizes to the cell membrane, while truncated variants may mislocalize to the cytoplasm .

The protein has a molecular mass of approximately 25.2 kDa and consists of 4 exons, with exon 3 being particularly crucial for proper protein function and localization . The full protein contains transmembrane domains that establish its topology within the lipid bilayer, which is critical for its biological activity.

What is the expression pattern of Tm4sf20 in murine tissues?

Tm4sf20 demonstrates distinct expression patterns in mammalian tissues, with particularly notable expression in neural tissues. It is readily detectable in multiple regions of the adult mouse brain including:

  • Parietal lobe

  • Occipital lobe

  • Hippocampus

  • Pons

  • White matter

  • Corpus callosum

  • Cerebellum

This neurological expression pattern correlates with the observed phenotypes in models with Tm4sf20 mutations, particularly those affecting white matter integrity and neurological function. For researchers designing tissue-specific experiments, these expression patterns provide important guidance for selecting appropriate experimental models.

How does ceramide influence Tm4sf20 function?

Ceramide plays a crucial regulatory role in Tm4sf20 function through a mechanism known as regulated alternative translocation (RAT). In the presence of ceramide, Tm4sf20's membrane topology undergoes significant alterations, reversing the direction through which transmembrane helices are translocated into the endoplasmic reticulum membrane during translation .

This ceramide-induced conformational change has significant functional consequences:

  • It converts Tm4sf20 from an inhibitor to an activator of CREB3L1 processing

  • It stimulates RIP activation of CREB3L1

  • It ultimately leads to increased collagen synthesis

This unique regulatory mechanism provides researchers with an opportunity to study lipid-protein interactions in membrane protein function. For experimental manipulation of this pathway, ceramide can be introduced to cell culture systems at concentrations typically ranging from 5-25 μM, with monitoring of downstream CREB3L1 activation through appropriate reporter assays.

What are recommended protocols for expressing and purifying recombinant mouse Tm4sf20?

Successful expression and purification of recombinant mouse Tm4sf20 requires careful attention to expression systems, tags, and purification conditions. Based on established protocols, the following methodological approach is recommended:

  • Expression System Selection: HEK293T cells have proven effective for maintaining proper folding and post-translational modifications of Tm4sf20 . While bacterial systems may yield higher protein quantities, mammalian expression systems better preserve the native conformation of transmembrane proteins.

  • Tagging Strategy: C-terminal tagging with MYC/DDK (FLAG) tags provides reliable detection and purification without interfering with transmembrane domain insertion. The tag placement should avoid disrupting the membrane topology .

  • Purification Protocol:

    • Lyse cells in buffer containing 25 mM Tris-HCl (pH 7.3), with appropriate detergents

    • Perform affinity chromatography using anti-DDK antibodies

    • Elute with competitive peptides

    • Achieve >80% purity as determined by SDS-PAGE and Coomassie blue staining

  • Storage Conditions: Store at -80°C in a buffer containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol. Avoid repeated freeze-thaw cycles to maintain protein stability and activity .

For proteins intended for functional studies, concentration should be maintained at >50 μg/mL as determined by microplate BCA method to ensure sufficient material for downstream applications .

How can researchers analyze the effect of Tm4sf20 mutations on protein localization?

To effectively analyze the effects of Tm4sf20 mutations on protein localization, researchers should implement a comprehensive analytical approach:

  • Construct Generation: Create N-terminal GFP-tagged constructs of both wild-type Tm4sf20 and mutant variants (such as the ΔEX3 variant) by cloning into appropriate expression vectors like pcDNA6.2-N-EmGFP .

  • Cellular Model Selection: Neuroblastoma cell lines such as Neuro-2a provide an appropriate cellular context, particularly for neurological studies, though HEK293 cells are also suitable for general localization studies .

  • Transfection and Imaging Protocol:

    • Transiently transfect cells with GFP-tagged constructs

    • After 24-48 hours, fix cells with 4% paraformaldehyde

    • Counterstain with membrane markers and nuclear dyes

    • Image using confocal microscopy with appropriate filter sets

  • Quantitative Analysis: Score at least 50 transfected cells in duplicate experiments, categorizing localization patterns (membrane vs. cytoplasmic) .

This methodological approach revealed that while wild-type Tm4sf20 properly localizes to the cell membrane, truncated variants (such as those missing exon 3) consistently mislocalize to the cytoplasm, providing important insights into the structural requirements for proper trafficking .

What experimental approaches can assess Tm4sf20's role in regulated intramembrane proteolysis?

Investigating Tm4sf20's role in regulated intramembrane proteolysis (RIP) of CREB3L1 requires multiple complementary experimental approaches:

  • Minigene Assays: To analyze splicing effects of genomic deletions, researchers can generate minigene constructs by PCR amplification of genomic fragments spanning relevant exons (e.g., exon 2 through exon 4). These constructs can be transfected into cell lines, followed by RT-PCR analysis to determine splicing patterns .

  • Nonsense-Mediated Decay Analysis: Culturing cells in the presence or absence of nonsense-mediated decay inhibitors (e.g., Emetine) can help determine the stability of mutant transcripts .

  • CREB3L1 Processing Assays:

    • Co-express tagged versions of Tm4sf20 and CREB3L1

    • Monitor CREB3L1 cleavage by western blotting for N-terminal and C-terminal fragments

    • Compare processing efficiency between wild-type and mutant Tm4sf20

  • Ceramide Response Studies: Treat cells with varying concentrations of ceramide to assess the conversion of Tm4sf20 from an inhibitor to an activator of CREB3L1 processing .

These methodologies enable researchers to dissect the molecular mechanisms by which Tm4sf20 regulates CREB3L1 processing and how mutations affect this regulatory function.

What is known about the TM4SF20 deletion and its population distribution?

The TM4SF20 deletion represents a significant genetic variant with strong population specificity. This complex 4 kb deletion in 2q36.3 removes the penultimate exon 3 of TM4SF20 and has been identified predominantly in populations from Southeast Asia .

Population Distribution Data:

PopulationCarrier FrequencyAllele FrequencySample Size
Vietnamese Kinh2.3% (46/2,018)1.1%2,018
Other Southeast Asian groupsPresent but frequency variesNot fully determinedLimited
Non-Southeast Asian populationsExtremely rareNot observed in 1000 Genomes Project1,092

This deletion appears on a common genetic background with shared haplotype in Thai, Burmese, and Vietnamese subpopulations, strongly suggesting that it represents a founder mutation in Southeast Asia .

For researchers conducting genetic studies in these populations, screening for this deletion is particularly important when investigating developmental delay, language disorders, or white matter abnormalities.

How does the TM4SF20 exon 3 deletion affect protein function and associated phenotypes?

The deletion of exon 3 in TM4SF20 has profound effects on both protein structure/function and clinical phenotypes:

Molecular Consequences:

  • The deletion causes splicing of exon 2 directly to exon 4

  • This introduces a premature stop codon (p.Met84*)

  • The resulting truncated protein lacks two of its four transmembrane domains

  • While the mutant protein remains stable, it fails to target to the plasma membrane and accumulates in the cytoplasm

Associated Phenotypes:

  • Early childhood communication disorders

  • White matter hyperintensities (WMHs) observed in approximately 70% of carriers

  • Variable expressivity, with some cases showing more severe neurological sequelae

  • The severity of language delay does not necessarily correlate with the extent of white matter abnormalities

Research suggests the most likely disease mechanism is a neurotoxic effect of the truncated protein rather than haploinsufficiency or a dominant-negative effect, as evidenced by a homozygous individual whose phenotype was not markedly different from heterozygotes .

What neuroimaging findings are associated with TM4SF20 mutations?

TM4SF20 mutations, particularly the exon 3 deletion, are associated with distinctive neuroimaging findings that can inform both research and clinical practice:

  • Characteristic White Matter Hyperintensities (WMHs):

    • Punctate and multifocal T2 hyperintensities in the periventricular and deep white matter

    • Present in approximately 70% of deletion carriers

    • Observable in both affected children and carrier parents

  • Distribution Pattern:

    • Variable extent, ranging from 1-2 focal punctate lesions to multifocal lesions

    • May affect all lobes of both cerebral hemispheres

    • Present at a significantly higher frequency than in general pediatric populations or those with unexplained developmental delay

  • Methodological Considerations for Research:

    • Brain MRI should be performed at 1.5 T or higher with 5 mm slice thickness

    • Recommended sequences include sagittal T1-weighted imaging, axial T2-weighted imaging, and T2-weighted FLAIR imaging

    • Diffusion-weighted imaging and gradient echo imaging provide additional valuable information

For research protocols, blinded evaluation by at least two neuroradiologists is recommended to ensure reliable assessment of these subtle but significant white matter changes.

How can mouse models be used to study Tm4sf20 function and pathology?

Mouse models provide valuable tools for investigating Tm4sf20 function and associated pathologies. Current knowledge and recommended approaches include:

  • Existing Models:

    • Tm4sf20-null mice are viable and exhibit neurobehavioral phenotypes, including decreased anxiety-like responses during open field testing

    • These models can serve as baseline comparisons for more sophisticated genetic manipulations

  • Recommended Model Development Strategies:

    • CRISPR/Cas9 genome editing to generate deletion models mimicking the human exon 3 deletion

    • Knock-in models expressing the truncated Tm4sf20 protein to study toxic gain-of-function effects

    • Conditional models with tissue-specific expression to isolate neurological effects

  • Phenotypic Analysis:

    • Comprehensive neurobehavioral assessment focusing on communication and language-related behaviors

    • Advanced neuroimaging including DTI (diffusion tensor imaging) to assess white matter integrity

    • Histopathological examination of white matter development and myelination

  • Molecular Analyses:

    • RNA-seq to identify downstream transcriptional changes

    • Proteomics to characterize altered protein-protein interactions

    • In vivo assessment of CREB3L1 processing and collagen synthesis

When designing mouse model experiments, researchers should consider the variable expressivity observed in human carriers and implement multiple testing paradigms to capture the spectrum of potential phenotypes.

What protein-protein interaction studies are relevant for Tm4sf20 research?

Understanding Tm4sf20's protein interaction network is crucial for elucidating its cellular functions and disease mechanisms. Recommended approaches include:

  • Known Interaction Partners to Investigate:

    • Integrins: Tm4sf20 interacts with integrins to influence cell adhesion, proliferation, and motility

    • CREB3L1: Tm4sf20 regulates CREB3L1 through inhibition of regulated intramembrane proteolysis

    • Components of the VEGF signaling pathway: Tm4sf20 may promote angiogenic activities through VEGF induction

  • Recommended Methodologies:

    • Co-immunoprecipitation with tagged Tm4sf20 variants

    • Proximity ligation assays for detecting in situ protein interactions

    • FRET/BRET analyses for studying dynamic interactions

    • Mass spectrometry-based interactome profiling

  • Comparative Analyses:

    • Compare interaction profiles between wild-type and mutant Tm4sf20

    • Assess how ceramide treatment affects protein interaction networks

    • Evaluate tissue-specific interaction patterns, particularly in neural tissues

  • Functional Validation:

    • Knockdown/knockout studies of identified interactors

    • Mutational analysis of interaction domains

    • Cell-based functional assays to assess the significance of identified interactions

These approaches will help establish the molecular context in which Tm4sf20 functions and provide insights into how mutations disrupt normal cellular processes.

What are common challenges in working with recombinant Tm4sf20 and how can they be addressed?

Working with transmembrane proteins like Tm4sf20 presents several technical challenges. Here are evidence-based solutions to common issues:

  • Protein Solubility and Stability Issues:

    • Challenge: Maintaining proper folding and solubility of transmembrane proteins.

    • Solution: Use mammalian expression systems like HEK293T cells rather than bacterial systems . Store at -80°C in buffer containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol .

  • Low Expression Yields:

    • Challenge: Insufficient protein production for downstream applications.

    • Solution: Optimize codon usage for expression system, use strong promoters, and consider fusion partners that enhance expression while maintaining function.

  • Protein Mislocalization:

    • Challenge: Ensuring proper trafficking to the plasma membrane.

    • Solution: Carefully design tag placement to avoid disrupting trafficking signals. C-terminal tags generally have less impact on trafficking than N-terminal tags for Tm4sf20 .

  • Functional Assay Development:

    • Challenge: Establishing reliable readouts for Tm4sf20 activity.

    • Solution: Leverage CREB3L1 processing as a functional readout, using reporter systems that monitor CREB3L1 cleavage and nuclear translocation.

  • Verification of Protein Integrity:

    • Challenge: Ensuring the recombinant protein maintains native structure.

    • Solution: Combine multiple analytical methods including SDS-PAGE, Western blotting, and mass spectrometry. Aim for >80% purity as determined by SDS-PAGE and Coomassie blue staining .

These technical considerations can significantly improve experimental outcomes when working with this challenging but important transmembrane protein.

How can researchers verify the effects of ceramide on Tm4sf20 membrane topology?

To verify ceramide's effects on Tm4sf20 membrane topology through regulated alternative translocation (RAT), researchers should implement a systematic experimental approach:

  • Experimental Design for Topology Analysis:

    • Generate constructs with epitope tags in different loops and termini

    • Perform protease protection assays before and after ceramide treatment

    • Use glycosylation mapping with inserted N-glycosylation sites

    • Employ cysteine accessibility methods to map exposure of specific residues

  • Ceramide Treatment Protocol:

    • Use cell-permeable ceramide analogs (C2-ceramide or C6-ceramide)

    • Titrate concentrations (typically 5-25 μM)

    • Determine optimal treatment duration (usually 4-24 hours)

    • Include appropriate vehicle controls

  • Functional Verification:

    • Monitor CREB3L1 processing as a functional readout for topology changes

    • Measure downstream collagen synthesis using quantitative RT-PCR or ELISA

    • Compare wild-type Tm4sf20 with topology-restricted mutants

  • Imaging Approaches:

    • Use super-resolution microscopy to visualize membrane reorganization

    • Apply FRET-based biosensors to detect conformational changes

    • Perform live-cell imaging to monitor dynamic topology changes

By combining these approaches, researchers can establish a comprehensive understanding of how ceramide alters Tm4sf20 topology and the functional consequences of these structural changes.

What emerging technologies might advance Tm4sf20 research?

Several cutting-edge technologies show promise for advancing our understanding of Tm4sf20 function and pathology:

  • Single-Cell Technologies:

    • Single-cell RNA-seq to map Tm4sf20 expression patterns with unprecedented resolution

    • Single-cell proteomics to determine cell-specific protein interaction networks

    • These approaches could reveal cell type-specific functions of Tm4sf20 in the developing brain

  • Advanced Imaging Techniques:

    • Cryo-electron microscopy for structural determination of Tm4sf20 alone and in complex with interaction partners

    • Lattice light-sheet microscopy for tracking Tm4sf20 dynamics in living cells with minimal phototoxicity

    • These methods would provide insights into the structural basis of Tm4sf20 function

  • Genome Engineering Advances:

    • Base editing technologies for introducing precise mutations

    • Prime editing for more complex genetic manipulations

    • Inducible CRISPR systems for temporal control of gene modification

    • These tools would enable more sophisticated modeling of Tm4sf20 variants

  • Organoid Technologies:

    • Brain organoids from patient-derived iPSCs to model neurodevelopmental aspects

    • Vascularized organoids to study Tm4sf20's role in angiogenesis

    • These systems would bridge the gap between cellular and animal models

Integrating these technologies into Tm4sf20 research programs would significantly enhance our understanding of its basic biology and pathological mechanisms.

What are the unresolved questions in Tm4sf20 biology?

Despite progress in understanding Tm4sf20, several critical questions remain unanswered:

  • Developmental Function:

    • How does Tm4sf20 contribute to normal language development?

    • What is its role in white matter formation and maintenance?

    • Is there a critical developmental window during which Tm4sf20 function is most crucial?

  • Molecular Mechanism Questions:

    • What is the precise molecular mechanism by which truncated Tm4sf20 causes neurotoxicity?

    • How does the protein normally regulate CREB3L1 processing at the molecular level?

    • What additional substrates might be regulated by Tm4sf20?

  • Therapeutic Potential:

    • Could targeting the ceramide-Tm4sf20-CREB3L1 pathway provide therapeutic opportunities?

    • Are there compounds that could correct the mislocalization of mutant Tm4sf20?

    • Could early intervention strategies mitigate the language delay phenotypes in deletion carriers?

  • Evolutionary Considerations:

    • Why is the deletion allele maintained at relatively high frequency in Southeast Asian populations?

    • Does it confer any selective advantage in certain contexts?

    • How conserved is Tm4sf20 function across species?

Addressing these questions will require multidisciplinary approaches and continued technological innovation in the field.

How can Tm4sf20 research inform our understanding of language disorders?

The connection between Tm4sf20 mutations and language disorders provides a valuable window into the molecular basis of communication development:

  • Genotype-Phenotype Correlations:

    • The strong association between the exon 3 deletion and language delay establishes a clear genetic contribution to this developmental domain

    • The variable expressivity suggests the importance of genetic modifiers and environmental factors

    • These insights can help refine our understanding of language disorder heterogeneity

  • Biological Pathways:

    • The Tm4sf20-CREB3L1 pathway reveals potential molecular mechanisms underlying language development

    • The white matter abnormalities suggest the importance of proper connectivity in language circuits

    • These findings might highlight previously unrecognized pathways relevant to language acquisition

  • Population-Specific Considerations:

    • The high prevalence of the deletion in Southeast Asian populations (1.1% allele frequency in Vietnamese Kinh) suggests it may contribute significantly to language disorders in these populations

    • This provides a rationale for population-specific screening approaches

    • It highlights the importance of studying diverse populations in neurodevelopmental research

Understanding these connections can guide both basic research and clinical approaches to language disorders, potentially leading to more targeted interventions for affected individuals.

What are practical considerations for researchers studying Tm4sf20 in different model systems?

Researchers working with Tm4sf20 across different model systems should consider the following practical guidance:

  • Cell Culture Models:

    • Select appropriate cell types: neuronal cell lines for neurodevelopmental studies, endothelial cells for angiogenesis studies

    • Consider the endogenous expression of Tm4sf20 and relevant interaction partners

    • Use inducible expression systems to control protein levels and timing

    • Implement ceramide treatments to study regulated alternative translocation

  • Mouse Models:

    • Consider both knockout and knock-in approaches to distinguish loss- and gain-of-function effects

    • Implement comprehensive neurobehavioral testing with emphasis on language-related behaviors

    • Perform longitudinal imaging studies to track white matter development

    • Complement with ex vivo tissue analysis

  • Human Studies:

    • Focus recruitment efforts on Southeast Asian populations where the deletion is prevalent

    • Implement standardized language assessments appropriate for the study population

    • Conduct detailed neuroimaging with standardized protocols to detect white matter abnormalities

    • Consider longitudinal designs to track developmental trajectories

  • iPSC-Derived Models:

    • Generate isogenic lines to control for genetic background

    • Differentiate into relevant cell types (neurons, oligodendrocytes, endothelial cells)

    • Assess effects on cell migration, adhesion, and process formation

    • Evaluate responses to ceramide treatment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.