Recombinant Mouse Transmembrane 4 L6 family member 4 (Tm4sf4)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

Tm4sf4 regulates critical biological pathways:

  • Cell Migration: Inhibits Rho-activated migration and actin organization in a ROCK-independent manner .

  • Pancreatic Development: Opposes Nkx2.2 activity by suppressing α/β-cell differentiation while promoting ε-cell fates in zebrafish models .

  • Cancer Progression: Enhances hepatocellular carcinoma (HCC) aggressiveness via mitochondrial dysfunction and oxidative phosphorylation .

Research Applications

Recombinant Tm4sf4 is utilized in:

  • Mechanistic Studies: Investigating tetraspanin-integrin interactions in cancer metastasis .

  • Drug Development: Preclinical evaluation of anti-TM4SF antibodies to block tumor growth .

  • Diagnostic Tools: Detection via flow cytometry (e.g., Alexa Fluor® 488-conjugated antibodies) .

Clinical Relevance in Hepatocellular Carcinoma (HCC)

Tm4sf4 is overexpressed in HCCs and correlates with poor prognosis :

DatasetTM4SF4 Expression (HCC vs. Normal)Statistical Significance
TCGA (n=366)2.1-fold increasep<1×106p < 1 \times 10^{-6}
CNHPP (n=35)3.5-fold increasep<1×105p < 1 \times 10^{-5}
GSE14520 (n=225)4.2-fold increasep<0.01p < 0.01

Future Directions

Current research focuses on:

  • Validating Tm4sf4-mitochondrial interactions in HCC metabolism .

  • Developing TM4SF4-targeted therapies, including antibody-drug conjugates .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tm4sf4; Transmembrane 4 L6 family member 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tm4sf4
Target Protein Sequence
MCTGGCARCLGGTLIPLAVFGLLANILLFFPGGKVVNDKSHLSDEVWYFGGILGSGVLMI FPALVFLGLQNNDCCGCCGNEGCGKRFAMFTSTLFAVIGFLGAGYSFIVSAVSINKGPKC FMANGTWGYPFHDGDYLKDQALWSECEEPRDVVPWNLTLFSILLVIGGIQMVLCAIQVIN GLLGTLCGDCQCCGCCGGDGPV
Uniprot No.

Target Background

Function
Regulates the adhesive and proliferative status of intestinal epithelial cells. It can mediate density-dependent cell proliferation.
Database Links
Protein Families
L6 tetraspanin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane 4 L6 Family Member 4 (Tm4sf4) and what is its basic structure?

Transmembrane 4 L6 Family Member 4 (Tm4sf4) is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. The protein structure consists of four hydrophobic transmembrane domains, two extracellular loops, a small intracellular loop, and short intracellular amino and carboxy tails. This structural arrangement is characteristic of the tetraspanin superfamily, which comprises approximately 33 proteins localized in the plasma membrane . The protein is also referred to as intestine and liver tetraspan membrane protein (IL-TMP) in some literature .

Methodologically, researchers studying the structure of Tm4sf4 should consider:

  • Using predictive computational modeling to analyze transmembrane domains

  • Applying crystallography or cryo-EM techniques for detailed structural characterization

  • Employing epitope mapping to identify accessible domains for targeting

What is the expression pattern of Tm4sf4 in normal tissues?

Tm4sf4 shows a highly restricted expression pattern in normal tissues. Based on multiple transcript datasets (FANTOM5, GTEx, and HPA), Tm4sf4 expression is predominantly detected in the gastrointestinal tract and pancreas, with minimal expression in other tissues . Immunohistochemistry data has confirmed this tissue-restricted expression pattern at the protein level.

Specifically, Tm4sf4 demonstrates:

  • High expression in intestinal epithelial cells and hepatocytes

  • Low or undetectable levels in critical organs such as brain, lung, heart, and kidney

  • Significantly lower expression in normal tissues compared to other tetraspanin family members

When designing experiments to study Tm4sf4 expression, researchers should:

  • Include appropriate tissue panels covering both high and low expressing tissues

  • Employ multiple detection methods (qPCR, western blot, IHC) for validation

  • Consider single-cell approaches to characterize cell-type specific expression patterns

What are the primary biological functions of Tm4sf4?

Tm4sf4 plays several important roles in cellular physiology:

  • Regulation of cell adhesion: Tm4sf4 influences the adhesive properties of intestinal epithelial cells .

  • Modulation of cell proliferation: It mediates density-dependent cell proliferation, suggesting a role in contact inhibition and tissue homeostasis .

  • Signal transduction: Like other tetraspanins, Tm4sf4 mediates signal transduction events that regulate cell development, activation, growth, and motility .

To investigate these functions experimentally, researchers should consider:

  • Loss-of-function studies using siRNA or CRISPR-Cas9 approaches

  • Gain-of-function experiments with overexpression systems

  • Co-immunoprecipitation studies to identify binding partners

How does Tm4sf4 expression differ between hepatocellular carcinoma (HCC) and normal liver tissue?

Tm4sf4 demonstrates significant differential expression between HCC and normal liver tissue across multiple independent datasets. Extensive multiomics analyses have established Tm4sf4 as one of the top-ranked cell surface targets highly expressed in HCC .

Expression comparison data from multiple datasets:

DatasetSample SizeSignificance
TCGAn = 366p < 1 x 10^-6 compared to six other common HCC targets
GSE14520n = 225p < 0.01 compared to all seven common HCC targets
CNHPPn = 35p < 1 x 10^-5 compared to four other targets
CHCC (proteomics)n = 165p < 0.05 compared to four other protein targets

When studying Tm4sf4 expression in HCC contexts, researchers should:

  • Include matched tumor/normal tissue pairs whenever possible

  • Validate transcript-level findings with protein-level measurements

  • Consider the influence of tumor heterogeneity through single-cell approaches

What methodologies are most effective for studying Tm4sf4 at the single-cell level?

Single-cell RNA sequencing (scRNA-seq) has emerged as a powerful tool for characterizing Tm4sf4 expression patterns across heterogeneous cell populations. Recent studies have employed the following methodological approaches:

  • Dimensionality reduction visualization: Uniform Manifold Approximation and Projection (UMAP) has been utilized to visualize Tm4sf4 expression gradients across cell populations .

  • Correlation analysis: Genes highly correlated with Tm4sf4 expression (r ≥ 0.6) can be identified in both HCC and normal liver tissues to infer function .

  • Bioinformatic processing:

    • Quality control filtering of cells and genes

    • Normalization of expression values

    • Identification of highly variable genes

    • Principal component analysis

    • Clustering algorithms to identify discrete cell populations

    • Differential expression analysis across clusters

Researchers planning scRNA-seq experiments should:

  • Ensure adequate cell number capture from relevant populations

  • Include appropriate controls

  • Consider complementing with spatial transcriptomics for tissue context

  • Validate key findings with orthogonal methods like FACS or immunofluorescence

What evidence supports Tm4sf4 as a potential therapeutic target for immunotherapy approaches?

Tm4sf4 possesses several characteristics that make it an attractive target for immunotherapy development, particularly CAR T cell approaches against HCC:

  • Restricted normal tissue expression: Tm4sf4 shows minimal expression in critical organs (brain, lung, heart, kidney), reducing potential for on-target, off-tumor toxicity .

  • Favorable comparison to existing targets: Expression analysis across multiple datasets demonstrates that Tm4sf4 has a more favorable expression profile than seven other common HCC therapeutic targets (CD24, CD133/PROM1, CD147/BSG, EPCAM, GPC3, MET, and MUC1), with lower expression in normal tissues but higher expression in HCC cases .

  • Cell surface localization: As a tetraspanin family member, Tm4sf4 is localized to the plasma membrane, making it accessible to antibody-based therapeutic approaches .

When evaluating Tm4sf4 as an immunotherapy target, researchers should:

  • Assess binding accessibility of the extracellular domains

  • Evaluate potential cross-reactivity with other tetraspanin family members

  • Confirm expression patterns in preclinical models

What are the key considerations for producing recombinant Tm4sf4 protein for experimental studies?

Production of high-quality recombinant Tm4sf4 protein requires careful consideration of several factors:

  • Expression system selection:

    • Mammalian expression systems are preferred for maintaining native post-translational modifications, particularly glycosylation patterns

    • HEK293 or CHO cells are commonly used for tetraspanin protein production

  • Construct design:

    • Inclusion of appropriate tags (His, FLAG, etc.) for purification and detection

    • Consideration of signal peptides for proper membrane insertion

    • Potential modification of hydrophobic domains for improved expression

  • Purification strategies:

    • Detergent selection is critical for maintaining protein structure and function

    • Two-step purification (affinity chromatography followed by size exclusion) is recommended

    • Quality control by SDS-PAGE and western blotting is essential

Researchers should validate recombinant protein functionality through binding assays or functional tests to ensure the protein maintains its native properties.

What approaches are most effective for studying Tm4sf4 interactions with other proteins?

As a tetraspanin family member, Tm4sf4 likely functions through interactions with other membrane proteins and signaling molecules. Several methodological approaches are suitable for investigating these interactions:

  • Co-immunoprecipitation (Co-IP):

    • Requires careful detergent selection to maintain tetraspanin-enriched microdomains

    • Crosslinking approaches may help capture transient interactions

    • Validation with reverse Co-IP is recommended

  • Proximity labeling techniques:

    • BioID or APEX2 fusion constructs can identify proximal proteins in living cells

    • TurboID offers faster labeling kinetics for capturing dynamic interactions

  • Functional interaction assays:

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET) microscopy

    • Mammalian two-hybrid systems

When analyzing protein interaction data, researchers should consider:

  • Distinguishing direct from indirect interactions

  • Validation across multiple experimental systems

  • Confirmation in physiologically relevant contexts

How can researchers effectively analyze the functional consequences of Tm4sf4 modulation?

To understand the functional impact of Tm4sf4 in biological systems, researchers should consider multiple complementary approaches:

  • Gene expression modulation strategies:

    • CRISPR-Cas9 knockout for complete loss-of-function

    • siRNA or shRNA for transient knockdown

    • Overexpression systems with inducible control

    • Domain-specific mutants to pinpoint functional regions

  • Functional readouts:

    • Proliferation assays (especially density-dependent growth)

    • Adhesion assays to various substrates

    • Migration and invasion assays

    • Signaling pathway activation (particularly those associated with tetraspanins)

  • In vivo approaches:

    • Conditional knockout mouse models

    • Patient-derived xenograft models for HCC studies

    • Orthotopic models to maintain tissue microenvironment context

What bioinformatic approaches are recommended for analyzing Tm4sf4 in multi-omics studies?

Multi-omics analysis of Tm4sf4 requires integration of data from various platforms:

  • Transcriptomic analysis:

    • Differential expression analysis between conditions

    • Co-expression network analysis to identify functionally related genes

    • Pathway enrichment analysis of correlated genes

  • Proteomic integration:

    • Correlation of transcript and protein expression levels

    • Analysis of post-translational modifications

    • Protein-protein interaction network construction

  • Advanced analytical approaches:

    • Gene Ontology (GO) enrichment analysis for genes correlated with Tm4sf4 (r ≥ 0.6)

    • Weighted gene co-expression network analysis (WGCNA)

    • Multi-omics factor analysis (MOFA)

For example, GO enrichment analysis of genes highly correlated with Tm4sf4 expression in HCC has revealed functional associations with specific biological processes, providing insight into its role in cancer development .

How can researchers effectively compare Tm4sf4 with other potential therapeutic targets for HCC?

When evaluating Tm4sf4 as a therapeutic target relative to alternatives, researchers should implement a systematic comparative framework:

  • Comprehensive expression comparison:

    • Analysis across multiple independent datasets

    • Inclusion of both transcript and protein-level data

    • Evaluation in both normal tissues and disease states

  • Target ranking methodology:

    • Development of normalized scoring systems (e.g., mean normalized score of transcript expression [x̄T] and protein expression [x̄P])

    • Creation of weighted combinations (e.g., x̄TP) for consolidated ranking

    • Statistical comparison across targets with appropriate significance testing

  • Visualization approaches:

    • Violin plots arranged by median expression values to facilitate comparison

    • Box-and-whisker plots with statistical significance indicators

    • Heatmaps showing expression across multiple tissues and targets simultaneously

For example, one study employed a composite ranking approach that integrated both transcript and protein expression data across multiple independent datasets to identify Tm4sf4 as the top-ranked target (x̄TP: 0.938) among eight shortlisted candidates for HCC .

What considerations are important when designing gene expression studies to investigate Tm4sf4 in developmental or disease contexts?

When designing experiments to study Tm4sf4 expression patterns:

  • Developmental time course considerations:

    • Include multiple developmental stages

    • Consider both embryonic and postnatal timepoints

    • Analyze in the context of tissue differentiation

  • Disease progression analysis:

    • Include samples representing different disease stages

    • Consider inclusion of pre-malignant conditions

    • Analyze in relation to clinical outcomes

  • Technical and analytical considerations:

    • Select appropriate housekeeping genes for normalization

    • Consider splice variant analysis

    • Implement robust statistical approaches for small sample sizes

    • Use appropriate visualization methods for complex expression patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.