Recombinant Mouse Transmembrane 7 superfamily member 3 (Tm7sf3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Tm7sf3

Recombinant Mouse Transmembrane 7 Superfamily Member 3 (Tm7sf3) is a protein encoded by the Tm7sf3 gene (UniProt ID: Q9CRG1) in Mus musculus. This seven-transmembrane orphan receptor is involved in diverse cellular processes, including cytokine signaling modulation and metabolic regulation. Recombinant forms are produced using heterologous expression systems (e.g., E. coli or mammalian cells) for functional and structural studies .

Protein Architecture

  • Primary Structure: Comprises 544 amino acids (residues 22–565) with a calculated molecular weight of ~64.2 kDa .

  • Domains: Features seven transmembrane helices, characteristic of the G protein-coupled receptor (GPCR) superfamily.

  • Post-Translational Modifications: His-tagged variants (N-terminal) facilitate purification and detection .

Table 1: Recombinant Tm7sf3 Variants

PropertyE. coli-Expressed Mammalian Cell-Expressed
Expression SystemEscherichia coliMammalian Cells
TagN-terminal HisHis
Purity>90% (SDS-PAGE)>80%
Storage-20°C/-80°C (lyophilized)-20°C/-80°C (liquid/lyophilized)
Endotoxin LevelsNot specified<1.0 EU/μg

Expression Systems

  • Prokaryotic (E. coli): Cost-effective for large-scale production but lacks eukaryotic post-translational modifications .

  • Eukaryotic (Mammalian Cells): Preserves native folding and modifications, critical for functional assays .

Key Applications

  • Antibody Development: Anti-Tm7sf3 antibodies (e.g., BosterBio A15928) enable detection in Western blot (WB), ELISA, and immunohistochemistry (IHC) .

  • Structural Studies: Used in SDS-PAGE and crystallization trials to resolve transmembrane topology .

  • Functional Assays: Investigates roles in insulin secretion and lipid metabolism .

Role in Insulin Secretion

Tm7sf3 promotes insulin secretion in pancreatic β-cells, countering cytokine-induced apoptosis. siRNA-mediated knockdown of Tm7sf3 exacerbates β-cell death, highlighting its protective role in metabolic homeostasis .

Lipid Metabolism Regulation

  • Pathway Involvement: Modulates PPARA/PPARG-mediated lipid homeostasis via interactions with retinoid X receptors (RXRs) .

  • Cold Stress Adaptation: Upregulated in pearl gentian grouper under low-temperature stress, suggesting conserved roles in energy metabolism across species .

Table 2: Key Functional Annotations of Tm7sf3

FunctionMechanism/PathwayExperimental Model
Insulin secretion enhancementInhibition of β-cell apoptosissiRNA screens
Lipid homeostasisPPARD-RXR axis modulationMarine fish liver studies

Challenges and Future Directions

  • Structural Resolution: The seven-transmembrane architecture complicates crystallization; cryo-EM may advance conformational studies.

  • Therapeutic Potential: Unclear ligand-binding properties warrant further exploration for drug targeting metabolic disorders.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tm7sf3; Transmembrane 7 superfamily member 3; NARP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-565
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tm7sf3
Target Protein Sequence
NSSDGFLEFSVGKFTYFVLSKSSPQEAVLRHISSNVTFLLFQIHSQYQNTTVSFTKTLLP STSGTGNDRGLVFILRPEQAVCTWYLETGDTKPVQSVALTLSYSERDPIPGGCNLEFDLD IDPNLYLDYNFFETTIKFAPANIGYARATEPPPCDVSTSRESRWRLRYDVYQYFLPEGDL TEASLLHHLQRMAQVAQVKASAIKVATLTADDKTAVSFSSLPGQGVIYNVIVWDPSLNTS AAYVPVHTYACSFESVDGNCASPGRVSTKVFSTLFALLGLFVCFFGHRFWKTDLFFVGFI FLGFFFYILITRLTPLQYDVRLALTAVAGSFGGLLLVASWWRFGILTLCMLCVGLVLGFL VSSGTFFTPLGNLNVFHDDGVFWVTFSCIALLVPVIFMGCLRILNILACGVVGSYSVVLA VNSYMFTSLSYITLNVLRRALNTDFRGAFIRVPFQTNDYIILAVWGMLAVSGITLQIRRE RGQPPFPPHPYKLWKQERERRVTNILDPSHHIPPLRERLYGRVARIKELFQKEQPAGERT PLLL
Uniprot No.

Target Background

Function

TM7SF3 inhibits cytokine-induced death in pancreatic beta cells and promotes insulin secretion from these cells. It is a downstream transcriptional target of p53/TP53, acting as a pro-survival factor that mitigates cellular stress. TM7SF3 maintains protein homeostasis and promotes cell survival by attenuating endoplasmic reticulum (ER) stress and the subsequent unfolded protein response (UPR).

Gene References Into Functions
  1. TM7SF3 inhibits cytokine-induced cell death/apoptosis and insulin secretion in pancreatic beta cells. PMID: 21853325
Database Links

KEGG: mmu:67623

UniGene: Mm.278037

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Tm7sf3 and what are its basic structural features?

Tm7sf3, or Transmembrane 7 superfamily member 3, is a protein that belongs to the seven-transmembrane superfamily. The recombinant full-length mouse Tm7sf3 protein consists of amino acids 22-565 and is frequently produced with an N-terminal His tag when expressed in E. coli for research applications . Despite its classification as a transmembrane protein, Tm7sf3 has been surprisingly found to localize to nuclear speckles, which are eukaryotic nuclear bodies enriched in splicing factors . This unexpected localization provides insight into its functional versatility beyond traditional membrane-associated roles.

What cellular functions has Tm7sf3 been associated with?

Tm7sf3 has been identified as a p53-regulated homeostatic factor that attenuates cellular stress and the unfolded protein response (UPR) . It maintains protein homeostasis and promotes cell survival through attenuation of endoplasmic reticulum (ER) stress . Studies have shown that Tm7sf3 inhibits caspase 3/7 activation, thereby playing a critical role in preventing apoptosis . Additionally, it maintains cellular reducing power within physiological levels and reduces the cellular content of pro-apoptotic proteins such as FAS, Fas-associated via death domain and caspase-8 . An emerging role for Tm7sf3 is its involvement in pre-mRNA processing, as it regulates alternative splicing of over 330 genes, primarily at the 3′end of introns, by directly modulating the activity of splicing factors like HNRNPK .

What are the optimal expression systems for producing recombinant Tm7sf3?

For recombinant production of mouse Tm7sf3, E. coli has been successfully employed as an expression system . The protein sequence typically used corresponds to amino acids 22-565 of the mature protein, with an N-terminal His tag for purification purposes . For storage and stability, the recombinant protein is often supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol (5-50% final concentration) is recommended for long-term storage at -20°C/-80°C . Researchers should avoid repeated freeze-thaw cycles as this may compromise protein integrity .

What methods are effective for studying Tm7sf3 localization and trafficking?

Given the unexpected nuclear speckle localization of Tm7sf3, advanced microscopy techniques are essential for studying its subcellular distribution. Immunofluorescence microscopy with antibodies against both Tm7sf3 and known nuclear speckle markers (such as SC35 or other splicing factors) can be used to confirm co-localization . For dynamic studies of Tm7sf3 trafficking, live-cell imaging with fluorescently tagged Tm7sf3 constructs is recommended. Co-immunoprecipitation (Co-IP) experiments have been valuable in identifying Tm7sf3's interactions with nuclear proteins, revealing its associations with splicing factors such as DHX15, LARP7, HNRNPU, RBM14, and HNRNPK . For studying stress-induced changes in Tm7sf3 localization, researchers can induce cellular stress using compounds like H₂O₂ or tunicamycin and monitor alterations in the structure of nuclear speckles and Tm7sf3 distribution .

What RNA-seq and transcriptomic approaches are recommended for studying Tm7sf3's role in alternative splicing?

To comprehensively analyze Tm7sf3's effects on alternative splicing, total RNA sequencing followed by specialized bioinformatic analysis is recommended. The MAJIQ/VOILA algorithm has been successfully used to identify changes in local splicing variations (LSVs) between cells expressing siTM7SF3 and control cells . This approach revealed significant alterations in splicing of mRNAs derived from over 330 genes, some with multiple LSVs, encompassing differential splicing of cassette exons, retained introns, and increased usage of cryptic splice sites . RT-PCR analysis with primers designed to flank alternatively spliced regions can be used to validate specific splicing changes, as demonstrated for genes like PIG3, ATP5C1, MCL1, and EZH2 .

The following table summarizes key experimental approaches for analyzing Tm7sf3's role in alternative splicing:

Experimental ApproachApplicationKey Findings
Total RNA-seq with MAJIQ/VOILA algorithmGenome-wide analysis of splicing changes>330 genes with altered splicing patterns after Tm7sf3 silencing
RT-PCR with exon-specific primersValidation of specific splicing eventsTm7sf3 affects splicing of PIG3 (Ex4), MCL-1 (Ex2), EZH2, etc.
Stress-induced splicing analysisStudying Tm7sf3's role under stressTm7sf3 silencing inhibits H₂O₂-induced MCL1 splicing and tunicamycin-induced XBP-1 splicing
Cell-type specific analysisComparing splicing patterns across cell typesTm7sf3 can promote or inhibit splicing of the same gene depending on cell type

How can researchers analyze Tm7sf3's impact on the unfolded protein response (UPR)?

To study Tm7sf3's role in regulating the UPR, researchers should examine key markers of ER stress and the UPR pathway following Tm7sf3 manipulation. Analysis of inhibitory phosphorylation of eukaryotic translation initiation factor 2α (eIF2α) is crucial, as Tm7sf3 silencing has been shown to increase this phosphorylation . Expression analysis of UPR-associated transcription factors including ATF3, ATF4, and C/EBP homologous protein (CHOP) is also recommended, as these are upregulated following Tm7sf3 silencing . Both mRNA expression (using qRT-PCR) and protein levels (using Western blotting) should be assessed, as demonstrated for CHOP, where Tm7sf3 silencing approximately doubled CHOP protein levels in tunicamycin-treated MIN6 cells .

For comprehensive analysis, researchers can use stress inducers like thapsigargin (an inhibitor of sarco/endoplasmic reticulum Ca²⁺-ATPase), tunicamycin (an inhibitor of GlcNAc phosphotransferase and protein glycosylation), or pro-inflammatory cytokines (TNF-α, IL-1β, and IFN-γ) to trigger the UPR and observe how Tm7sf3 manipulation affects cellular responses .

What spatial transcriptomic methods can be applied to study Tm7sf3 expression patterns in tissue samples?

Modern spatial transcriptomic technologies allow researchers to analyze gene expression while preserving spatial information within tissue contexts. For studying Tm7sf3 expression patterns in tissue samples, several advanced methods can be applied :

  • Principal component analysis (PCA) can be used for dimensionality reduction to project high-dimensional gene expression data, including Tm7sf3 expression, into 2D or 3D visualizations .

  • For detecting spatial patterns of Tm7sf3 expression, methods like SpatialDE or Spark are recommended. Spark uses a generalized linear spatial model (GLSM) to directly model count data, offering better statistical power for detecting spatially variable genes . The model can be represented as:

    Where y(s) represents gene expression at sample location s, x(s) represents covariates such as batch effect and library size, b(s) is the spatial correlation pattern modeled as a Gaussian process, and the last term represents random error .

  • For visual representation of spatial expression patterns, t-distributed stochastic neighbor embedding (t-SNE) can be used, which calculates pairwise similarity based on probability density functions in high-dimensional space and projects data to lower dimensions while preserving relationships between points .

How does Tm7sf3 function in pancreatic β-cells and what is its role in diabetes models?

Tm7sf3 has been identified as a potential new player in the inhibition of cytokine-induced death and in the promotion of insulin secretion from pancreatic β-cells . In β-cell models, Tm7sf3 maintains cellular reducing power within physiological levels and reduces the cellular content of pro-apoptotic proteins . Silencing of Tm7sf3 in pancreatic β-cells accelerates ER stress and activates the UPR, involving inhibitory phosphorylation of eIF2α and increased expression of stress-induced transcription factors like ATF3, ATF4, and CHOP, ultimately leading to apoptosis .

Experimental evidence shows that overexpression of Tm7sf3 in dispersed human islets decreases cytokine-induced caspase activity by approximately 65%, demonstrating its protective effect against stress-induced β-cell death . Importantly, these protective effects are observed both under basal conditions and under stress conditions induced by pro-inflammatory cytokines that are relevant to diabetes pathogenesis (TNF-α, IL-1β, and IFN-γ) . Given these findings, targeting Tm7sf3 or its downstream pathways represents a potential therapeutic strategy for preserving β-cell function and viability in diabetes.

What is known about Tm7sf3's role in liver fibrosis and potential therapeutic implications?

This molecular mechanism has been observed in both mouse and human liver cells, suggesting evolutionary conservation of this pathway . The discovery of this signaling module provides potential therapeutic targets for liver fibrosis. For instance, the recently developed molecule ASO 56 has been found to reduce liver scarring in a mouse model and may represent a potential treatment for primary sclerosing cholangitis (PSC) . Researchers investigating Tm7sf3 in liver fibrosis models should consider examining its expression patterns in different stages of fibrosis, its interaction with hnRNPU, and the resulting alternative splicing of TEAD1.

How does Tm7sf3's regulation of alternative splicing contribute to stress responses and disease states?

Tm7sf3 regulates alternative splicing of over 330 genes, with effects observed both under basal conditions and under cellular stress . This splicing regulation has significant implications for stress responses and disease states. For example, silencing of Tm7sf3 inhibits stress-induced alternative splicing of MCL1 (induced by H₂O₂) and XBP-1 (induced by tunicamycin) . Since MCL1 is an anti-apoptotic factor and XBP-1 is a key mediator of the UPR, Tm7sf3's regulation of their splicing directly impacts cell survival under stress conditions.

Interestingly, Tm7sf3's effects on alternative splicing can vary depending on cell type. For instance, silencing of Tm7sf3 in U2OS cells inhibits alternative splicing of PIG3 and ATP5C1, while in HFF cells it promotes alternative splicing of EZH2 . This context-dependent regulation suggests that Tm7sf3 may engage with different sets of splicing factors depending on the cellular environment and stress conditions.

The broad impact of Tm7sf3 on alternative splicing is further evidenced by transcriptomic analysis showing that silencing of Tm7sf3 results in differential expression of 1465 genes (approximately 7% of the human genome), with 844 genes upregulated and 621 genes downregulated . This extensive influence on gene expression underscores Tm7sf3's potential significance in various disease states where alternative splicing plays a pathogenic role.

What are the key unanswered questions about Tm7sf3 function and regulation?

Despite significant advances in understanding Tm7sf3's functions, several important questions remain. First, the precise mechanism by which a seven-transmembrane protein localizes to nuclear speckles remains unclear and warrants further investigation . Second, while Tm7sf3 is known to be regulated by p53, with p53 physically associating with the Tm7sf3 gene at a site approximately 1000 bp downstream of the transcription start site , the complete regulatory network controlling Tm7sf3 expression across different tissues and stress conditions requires further elucidation. Third, the full spectrum of Tm7sf3's protein-protein interactions and how these are modulated during different cellular processes needs more comprehensive mapping. Lastly, the potential role of Tm7sf3 in diseases beyond diabetes and liver fibrosis, particularly in conditions involving ER stress and alternative splicing dysregulation, represents an important area for future research.

What emerging technologies might advance Tm7sf3 research in the coming years?

Several emerging technologies hold promise for advancing Tm7sf3 research. Single-cell spatial transcriptomics could provide unprecedented insights into Tm7sf3 expression patterns within heterogeneous tissues like pancreatic islets or liver, revealing cell type-specific functions . CRISPR-based approaches for precise genome editing could enable more sophisticated functional studies of Tm7sf3, including the creation of domain-specific mutations to dissect structure-function relationships. Proximity labeling methods such as BioID or APEX could help map the complete Tm7sf3 interactome under different cellular conditions. Finally, advanced computational approaches integrating transcriptomic, proteomic, and phenotypic data could help place Tm7sf3 within broader cellular networks and signaling pathways, potentially revealing new therapeutic targets related to Tm7sf3 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.