Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 1 (Tmco1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmco1; Calcium load-activated calcium channel; CLAC channel; Transmembrane and coiled-coil domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmco1
Target Protein Sequence
MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITES AGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFT PLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGP PPPSGKFS
Uniprot No.

Target Background

Function

Transmembrane and coiled-coil domain-containing protein 1 (TMCO1) is a calcium-selective channel crucial for preventing overfilling of calcium stores, thus playing a vital role in calcium homeostasis. In response to endoplasmic reticulum (ER) overload, TMCO1 assembles into a homotetramer, forming a functional calcium-selective channel that regulates ER calcium content. It is a component of a ribosome-associated ER translocon complex involved in the transport of multi-pass membrane proteins into the ER membrane and their biogenesis. Specifically, TMCO1, along with SEC61 and TMEM147, forms the lipid-filled cavity within the translocon. TMEM147 may insert hydrophobic segments of multi-pass membrane proteins from the lumen into this central membrane cavity, a process regulated by SEC61. TMCO1 may insert hydrophobic segments of nascent chains from the cytosol into the cavity.

Gene References Into Functions
  1. TMCO1 provides a protective mechanism against endoplasmic reticulum calcium overload. PMID: 27212239
Database Links
Protein Families
TMCO1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Tmco1 and how is it conserved across species?

Tmco1 consists of seven coding exons with a 564-bp coding region encoding a predicted protein of 188 amino acids. Structural analysis has identified:

  • Two transmembrane segments (amino acids 10-31 for TM1 and amino acids 90-109 for TM2)

  • A coiled-coil domain (amino acids 32-89)

  • Three phosphorylation sites (phosphoserines) involved in signaling networks

Amino acid sequence comparison shows remarkable conservation across species, with 100% homology among eight mammalian TMCO1 orthologs, suggesting critical evolutionary importance . This high degree of conservation, combined with ubiquitous expression in human adult and fetal tissues, indicates a fundamental role for TMCO1 in cellular function.

What is the primary function of Tmco1 in cellular homeostasis?

Tmco1 functions primarily as a calcium load-activated channel in the endoplasmic reticulum (ER). It forms active homotetramers that open in response to overfilling of ER Ca²⁺ stores, effectively functioning as a "leak channel" to prevent calcium overload . Under basal conditions, TMCO1 also functions as a leak channel even without overfilled Ca²⁺ stores. This regulation is critical for:

  • Maintaining ER calcium homeostasis

  • Preventing ER stress

  • Regulating cell death pathways

  • Supporting proper protein folding and processing

Research demonstrates that TMCO1 knockdown increases endoplasmic reticulum Ca²⁺ stores, as evidenced by increased Ca²⁺ release upon treatment with ionomycin, CPA, and ATP in the absence of extracellular Ca²⁺ .

Where is Tmco1 expressed in mouse tissues and how does expression differ across developmental stages?

Tmco1 demonstrates ubiquitous expression across multiple tissues. RT-PCR analyses reveal universal expression in all human tissues examined, with relatively higher levels in adult thymus, prostate, and testis . NCBI's EST Profile Viewer confirms expression in 42 of 45 adult tissues.

Tissue TypeRelative ExpressionNotable Features
ThymusHighImmune function
ProstateHighReproductive system
TestisHighReproductive system
BrainModerateCorpus callosum development
BoneModerateOsteoblast function
EyeModerateAssociated with glaucoma

Expression is noted at all developmental stages from embryo to adult, indicating Tmco1's importance throughout the lifespan .

What are the most effective techniques for generating and validating Tmco1 knockout models?

Several approaches have proven effective for generating Tmco1 knockout models:

CRISPR/Cas9 Gene Editing:

  • Target exon 1 of the Tmco1 locus for frameshift mutations

  • Verify complete ablation of TMCO1 protein levels using Western blot analysis

  • Screen for homozygous knockouts (Tmco1⁻/⁻) via genomic DNA sequencing

Conditional Knockouts:
Particularly useful for tissue-specific studies:

  • Flox critical exons (typically exon 2) with loxP sites

  • Cross with tissue-specific Cre recombinase expressing mice

  • Validate using tissue-specific RT-PCR and Western blot analysis

Validation Methods:

  • Genotyping using PCR with primers spanning the targeted region

  • Western blot confirmation of protein absence

  • RT-PCR to confirm transcript disruption

  • Phenotypic assessment for characteristic features (craniofacial abnormalities, bone density changes)

  • Functional assays for calcium homeostasis disruption

What are the methodological considerations when measuring calcium dynamics in Tmco1-deficient cells?

When measuring calcium dynamics in Tmco1-deficient cells, researchers should consider:

Experimental Design:

  • Baseline Measurements: Establish resting cytosolic and ER Ca²⁺ levels using appropriate indicators

  • Store Depletion Protocols: Test ER Ca²⁺ content using:

    • Ionomycin in Ca²⁺-free media (measures total releasable Ca²⁺)

    • Cyclopiazonic acid (CPA) or thapsigargin (specific SERCA inhibitors)

    • IP₃-generating agonists (e.g., ATP for purinergic receptors)

Technical Considerations:

  • Use ratiometric dyes (Fura-2) for quantitative measurements

  • Implement single-cell imaging for heterogeneous responses

  • Include parallel measurements of mitochondrial Ca²⁺ uptake

  • Control for temperature (optimal at 37°C)

  • Ensure consistent cell density and passage number

Data Analysis:

  • Measure peak amplitude, area under curve, and recovery kinetics

  • Analyze store-operated calcium entry (SOCE) separately

  • Compare recovery rates to assess Ca²⁺ reuptake mechanisms

  • Account for changes in expression of other Ca²⁺ handling proteins

Research shows that Tmco1 silencing increases endoplasmic reticulum Ca²⁺ stores and delays recovery of cytosolic Ca²⁺ levels following IP₃R activation .

How can researchers effectively express and purify recombinant mouse Tmco1 for structural and functional studies?

Expression Systems:

SystemAdvantagesLimitationsRecommended Use
E. coliHigh yield, cost-effectiveLimited post-translational modifications, membrane protein solubility issuesStructure-function studies of isolated domains
Insect cellsBetter folding, some PTMsModerate cost, lower yieldFull-length protein studies, antibody production
Mammalian cellsNative folding and PTMsHigher cost, lower yieldFunctional studies, protein-protein interactions

Purification Protocol:

  • For Bacterial Expression:

    • Clone mouse Tmco1 cDNA into pET vectors with His-tag

    • Express in E. coli strains optimized for membrane proteins (C41/C43)

    • Solubilize using mild detergents (DDM, LMNG)

    • Purify via IMAC followed by size exclusion chromatography

  • For Mammalian Expression:

    • Use pcDNA3.1 with Twin-Strep or FLAG tag

    • Transiently transfect HEK293F cells

    • Harvest after 48-72 hours

    • Extract with digitonin or lauryl maltose neopentyl glycol

    • Purify with Strep-Tactin or anti-FLAG affinity chromatography

Functional Validation:

  • Reconstitute purified protein into liposomes for Ca²⁺ flux assays

  • Verify protein folding using circular dichroism

  • Assess oligomerization state using native PAGE or analytical ultracentrifugation

  • Confirm activity using calcium release assays

How does Tmco1 contribute to calcium homeostasis and what are the cellular consequences of its dysfunction?

Tmco1 functions as a critical regulator of ER calcium homeostasis through its role as a calcium load-activated release channel. The physiological consequences of Tmco1 dysfunction include:

Calcium Homeostasis Disruption:

  • Increased ER Ca²⁺ store levels

  • Delayed recovery of cytosolic Ca²⁺ following IP₃R activation

  • Altered calcium-dependent signaling pathways

  • Disrupted mitochondrial calcium uptake

Cellular Consequences:

  • Increased endoplasmic reticulum stress

  • Activation of unfolded protein response (UPR)

  • Altered transcriptional profiles

  • Changes in cell survival and proliferation pathways

  • Dysregulated autophagy and apoptosis mechanisms

In Tmco1-deficient mice, excessive Ca²⁺ signals result in upregulation of FGFs and over-activation of ERK signaling, leading to abnormal glial cell migration and corpus callosum development .

What is the role of Tmco1 in neural development, particularly in corpus callosum formation?

Tmco1 plays a critical role in corpus callosum (CC) development through calcium-dependent regulation of signaling pathways:

Mechanism of Action:

  • TMCO1 maintains Ca²⁺ homeostasis in developing neural cells

  • TMCO1 deficiency causes excessive Ca²⁺ signals

  • These signals upregulate FGFs and over-activate ERK signaling

  • This leads to excess glial cell migration and overpopulated midline glia cells in the indusium griseum

  • Overpopulated glia secrete Slit2, which repulses neural fiber bundle extension

  • This results in stalled white matter fiber bundles failing to cross the midline

Experimental Evidence:

  • Tmco1⁻/⁻ mice exhibit severe agenesis of corpus callosum

  • MEK inhibitors (which attenuate over-activated FGF/ERK signaling) significantly improve CC formation in Tmco1⁻/⁻ brains

  • Imaging studies in TMCO1-deficient patients show hypoplasia of corpus callosum, enlargement of septum pellicidum, and diffuse hypodensity of the grey matter

This research provides crucial insights for understanding abnormal corpus callosum development in TMCO1 defect syndrome and potential therapeutic interventions.

How does Tmco1 regulate bone development and homeostasis?

Tmco1 plays a significant role in bone development and homeostasis through regulation of osteoblast function:

Mechanistic Insights:

  • TMCO1 maintains calcium homeostasis in osteoblasts

  • TMCO1 deficiency alters transcription factor profiles in osteoblasts

  • In Tmco1-knockdown osteoblasts, RUNX2 levels decrease to approximately 10% of control levels

  • RUNX2 is a master regulator of osteoblast differentiation and function

Phenotypic Effects:
µCT analysis of Tmco1⁻/⁻ mice reveals:

  • Dramatic losses in bone mass, thickness, and trabeculation

  • Decreased trabecular bone volume (BV/TV)

  • Reduced bone mineral density (BMD)

  • Decreased trabecular thickness (Tb.Th) and cortical thickness (C.Th)

  • Increased trabecular spacing (Tb.Sp)

These findings suggest that TMCO1 deficiency disrupts normal bone formation and mineralization processes, contributing to the skeletal phenotypes observed in TMCO1 defect syndrome.

What is the molecular basis of TMCO1 defect syndrome and how do different mutations affect phenotype severity?

TMCO1 defect syndrome is caused by loss-of-function mutations in the TMCO1 gene. The syndrome presents with:

  • Craniofacial dysmorphism

  • Skeletal anomalies

  • Mental retardation

  • Corpus callosum abnormalities

Known Pathogenic Mutations:

  • c.139_140delAG (p.Ser47Ter) - Homozygous frameshift mutation found in Amish populations

    • Results in premature truncation, producing a protein only one-fourth the original length

    • Lacks the second transmembrane domain, coiled-coil domain, and phosphorylation sites

  • p.Arg87Ter (c.259 C>T) - Homozygous nonsense founder mutation identified in Turkish families

    • Associated with cerebrofaciothoracic dysplasia (CFT)

    • Results in complete loss of functional protein

Genotype-Phenotype Correlations:

  • Complete loss-of-function mutations appear to cause severe phenotypes

  • The severity of craniofacial abnormalities shows variable penetrance

  • Growth retardation and developmental delay are consistent features

  • Genetic background may influence phenotypic expression

The syndrome follows autosomal recessive inheritance, with heterozygous carriers showing no apparent phenotype .

Research has established a relationship between Tmco1 and glaucoma, with genetic variants associated with clinical parameters relevant to this eye disease:

Genetic Association:

  • Single nucleotide polymorphism (SNP) rs4656461 near the TMCO1 gene at chromosomal locus 1q24 is significantly associated with Primary Open Angle Glaucoma (POAG)

  • Individuals homozygous for the rs4656461 risk allele (GG) are diagnosed 4-5 years earlier than non-carriers

  • These genetic associations suggest TMCO1's involvement in glaucoma pathogenesis

Expression and Localization:

  • TMCO1 protein is expressed in most tissues of the human eye, including the trabecular meshwork and retina

  • The trabecular meshwork is particularly relevant as it regulates intraocular pressure, a major risk factor for glaucoma development

Research Models:

  • Mouse Models:

    • Tmco1 knockout mice show cornea opacity and increased leukocyte cell number

    • These phenotypes may relate to ocular hypertension mechanisms

  • Cell Culture Systems:

    • Trabecular meshwork cells with TMCO1 knockdown show altered calcium signaling

    • These can be used to study mechanistic aspects of TMCO1 in pressure regulation

  • Patient-Derived Samples:

    • Anterior chamber specimens from glaucoma patients with known TMCO1 variants

    • Enables correlation of genetic variation with biochemical and cellular changes

Understanding this relationship may lead to novel therapeutic approaches for glaucoma, particularly for patients with TMCO1 variants.

How does Tmco1 interact with the ER translocon complex and what is its role in multi-pass membrane protein biogenesis?

Tmco1 functions as part of a specialized ER translocon complex involved in the biogenesis of multi-pass membrane proteins:

Complex Components:

  • TMCO1 forms a complex with CCDC47 and the Nicalin-TMEM147-NOMO complex

  • This complex functions co-translationally with Sec61 during biogenesis of multi-pass membrane proteins

Substrate Specificity:
RIP-seq analysis (ribosome immunoprecipitation sequencing) reveals:

  • Strong enrichment for transcripts encoding secretory pathway transmembrane proteins

  • Depletion of single-pass proteins

  • Enrichment of multi-pass membrane proteins with four or more transmembrane domains (TMDs)

  • Includes numerous transporters, receptors, transferases, and hydrolases

Proposed Mechanism:

  • Hydrophobic segments of nascent chains that inefficiently engage with Sec61 access the membrane through the conserved cytosolic TMCO1 funnel

  • Segments that have translocated across the bilayer through Sec61 may access the membrane through the luminal TMEM147 funnel

  • The central cavity of the translocon shields the nascent chain to minimize misfolding and degradation

  • This organization increases efficiency in accommodating different biophysical and topological features of nascent chains

This model is consistent with TMCO1's evolutionary relationship to members of the Oxa1 superfamily, including YidC, Get1, EMC3, and Ylp1, which have evolved to function in different contexts but share the ability to move transmembrane segments into membranes.

What are the mechanisms by which Tmco1 influences female reproductive system function and fertility?

Tmco1 plays a critical role in female reproductive function, particularly affecting ovarian physiology:

Ovarian Phenotypes in Tmco1-Deficient Models:

  • Abnormal ovary morphology

  • Absent corpus luteum

  • Absent or decreased ovarian follicles (primordial, primary, secondary)

  • Decreased ovary weight

  • Small ovary size

  • Increased atretic ovarian follicle number

  • Oocyte degeneration

  • Premature ovarian failure

Hormonal Alterations:

  • Decreased circulating estradiol levels

  • Increased circulating follicle-stimulating hormone (FSH)

  • Increased circulating luteinizing hormone (LH)

  • These changes reflect disrupted hypothalamic-pituitary-gonadal axis feedback

Cellular Mechanisms:

  • Increased endoplasmic reticulum stress

  • Oxidative stress

  • Increased granulosa cell apoptosis

  • Impaired ovarian folliculogenesis

  • Disrupted calcium homeostasis critical for oocyte maturation and follicle development

Functional Consequences:

  • Decreased superovulation rate

  • Reduced female fertility

  • Decreased litter size

  • These reproductive defects have significant implications for understanding certain forms of female infertility

This research highlights TMCO1's importance in reproductive biology and suggests potential avenues for investigating certain forms of female infertility.

What are the emerging techniques for targeting TMCO1 in research and potential therapeutic applications?

Several emerging techniques show promise for targeting TMCO1 in both research and therapeutic contexts:

Research Tools:

  • CRISPR-Based Approaches:

    • CRISPRi for temporary, tunable repression of TMCO1 expression

    • CRISPRa for upregulation studies

    • Base editing for introducing specific point mutations

    • Prime editing for precise sequence modifications

  • Optogenetic Control:

    • Light-activated calcium channels fused to TMCO1 to study spatiotemporal regulation

    • Enables millisecond-scale control of calcium release

  • Structural Biology Techniques:

    • Cryo-EM for high-resolution structures of TMCO1 translocon complex

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to map conformational changes

Therapeutic Strategies:

  • Pharmacological Approaches:

    • Small molecule modulators of TMCO1 channel activity

    • Peptide inhibitors targeting TMCO1-specific interactions

    • Structure-based drug design targeting the coiled-coil domain

  • Gene Therapy Approaches:

    • AAV-mediated gene delivery for TMCO1 deficiency syndromes

    • mRNA therapeutics for temporary expression in cancer therapies

  • Targeted Protein Degradation:

    • PROTAC (Proteolysis targeting chimeras) technology for selective TMCO1 degradation

    • Context-specific degradation in disease tissues

Proof-of-Concept Research:

  • MEK inhibitors significantly improve corpus callosum formation in Tmco1⁻/⁻ brains, demonstrating the feasibility of targeting downstream pathways

  • Silencing TMCO1 enhances sensitivity to BCL-2/MCL-1 inhibitors in breast cancer cells, suggesting combination therapy potential

These approaches represent cutting-edge strategies for manipulating TMCO1 function with implications for both basic research and clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.