Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 5A (Tmco5a)

Shipped with Ice Packs
In Stock

Description

General Information

Tmco5a, or transmembrane and coiled-coil domain-containing protein 5A, is a protein-coding gene . It is predicted to be located in the membrane .

Synonyms and Identifiers

  • Official Full Name: Transmembrane and coiled-coil domains 5A

  • Symbol: Tmco5a

  • Synonyms: TMCO5

  • NCBI Gene ID: 145942

  • RGD ID: 1565206

  • UniProt No.: Q9D9D5

Expression and Function

TMCO5A is involved in several pathways and has different roles, with some functions cooperated with other proteins and some acted by TMCO5A itself .

Interactions

TMCO5A directly interacts with proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays . TMCO5A has 998 functional associations with biological entities spanning 8 categories: molecular profile, organism, functional term, phrase or reference, disease, phenotype or trait, chemical, structural feature, cell line, cell type or tissue, gene, protein, or microRNA .

Recombinant Mouse TMCO5A Protein

Recombinant Full Length Mouse Transmembrane And Coiled-Coil Domain-Containing Protein 5A(Tmco5A) Protein, His-Tagged, is a recombinant protein with a Full Length (1-303) amino acid sequence .

  • Source: E. coli

  • Species: Mus musculus (Mouse)

  • Tag: His-Tagged

  • AA Sequence: MEEQKENQLDYESEKMEILRLAQSKKNIISLNMDLERDMQRIDEANQELLLEIQEKENEI QRLEHEITQTGNPAEDEEWEKENYTVMEREQALQELEEETARLERKNETLVHSISELQRK LTRKSQKVIRYEQGDLETTPEESKVKLQQLESSCADQEKELGKIMEDYVFVSQLCEDQAL CIKKYQEALKRIEEELETGYLEREVSKVLSMDSERERSTSLNKMDGFISKGALRFSKSIF RSLLFSTLFFIRLLGYLIFHLSFINPDLLVNALPKILSRDVLWKLRCFLFPSLTLETEDM LPH

Gene-Chemical Interactions

TMCO5A expression can be affected by various chemicals :

ChemicalEffect
1,2-dichloroethaneincreases expression
2,3,7,8-tetrachlorodibenzodioxineaffects expression
2-palmitoylglycerolincreases expression
Aflatoxin B1decreases methylation
Antirheumatic drugincreases expression
Benzo[a]pyreneincreases methylation
Bisphenol Adecreases expression, decreases methylation
Caffeinedecreases phosphorylation
CGP 52608multiple interactions
Fenvalerateincreases expression
Kojic acidincreases expression
Monobutylphthalatedecreases expression
Propanaldecreases expression
Trovafloxacinincreases expression

Role in Bone Mineral Density

A study identified a variant in the TMCO5A gene associated with total body bone mineral density (TB-BMD) :

ChromosomePositionSNPAllelesFrequencyBetaP-valueSample Size
1538340874rs12442242A/G0.85-0.0514.94 × 10^{-10}66,403

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.

Synonyms
Tmco5a; Tmco5; Transmembrane and coiled-coil domain-containing protein 5A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmco5a
Target Protein Sequence
MEEQKENQLDYESEKMEILRLAQSKKNIISLNMDLERDMQRIDEANQELLLEIQEKENEI QRLEHEITQTGNPAEDEEWEKENYTVMEREQALQELEEETARLERKNETLVHSISELQRK LTRKSQKVIRYEQGDLETTPEESKVKLQQLESSCADQEKELGKIMEDYVFVSQLCEDQAL CIKKYQEALKRIEEELETGYLEREVSKVLSMDSERERSTSLNKMDGFISKGALRFSKSIF RSLLFSTLFFIRLLGYLIFHLSFINPDLLVNALPKILSRDVLWKLRCFLFPSLTLETEDM LPH
Uniprot No.

Target Background

Database Links
Protein Families
TMCO5 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structure and function of Tmco5a?

Transmembrane and coiled-coil domain-containing protein 5A (Tmco5a) is characterized by its transmembrane regions that anchor it to cellular membranes and its coiled-coil domains that mediate protein-protein interactions. Similar to other proteins with coiled-coil modules, the coiled-coil domain in Tmco5a likely forms α-helical structures that intertwine to create stable dimers or oligomers . The protein may function in membrane targeting and protein complex formation, similar to other transmembrane proteins with coiled-coil domains.

How do coiled-coil domains contribute to Tmco5a function?

Coiled-coil domains typically mediate protein dimerization or oligomerization, which is essential for protein function. As demonstrated with other proteins containing coiled-coil domains, these structures can be responsible for both homodimerization and membrane association . In the case of Tmco5a, the coiled-coil domain likely serves as a critical mediator of protein-protein interactions while also potentially contributing to membrane localization.

What experimental techniques can confirm the presence of functional coiled-coil domains in Tmco5a?

Several techniques can verify functional coiled-coil domains:

  • Circular Dichroism (CD) spectroscopy to confirm α-helical secondary structure with characteristic minima at 207 and 222 nm

  • Analytical gel filtration to determine oligomerization state

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine absolute molecular weight of complexes

  • Site-directed mutagenesis of key residues within the predicted coiled-coil region to disrupt dimerization

What expression systems are most suitable for recombinant Tmco5a production?

For transmembrane proteins like Tmco5a, considering the optimal expression system is crucial:

Expression SystemAdvantagesDisadvantagesBest For
E. coliCost-effective, high yield, rapid growthMay form inclusion bodies, lacks post-translational modificationsSoluble domains, preliminary studies
Mammalian cells (HEK293, CHO)Native post-translational modifications, proper foldingHigher cost, lower yield, slowerFull-length protein, functional studies
Insect cellsHigh expression levels, post-translational modificationsModerate cost, requires baculovirusCompromise between yield and authenticity
Cell-free systemsRapid, avoids toxicity issuesLimited scale, expensiveDifficult-to-express constructs

The choice depends on your downstream applications and whether you need the full-length protein or specific domains.

How can I optimize solubility of recombinant Tmco5a?

Transmembrane proteins often present solubility challenges. Consider these strategies:

  • Express only the soluble domains (e.g., only the coiled-coil domain) for interaction studies

  • Use fusion tags that enhance solubility (MBP, SUMO, thioredoxin) similar to approaches used with other coiled-coil containing proteins

  • Optimize expression conditions: lower temperature (16-20°C), reduced inducer concentration

  • For full-length protein, use appropriate detergents for membrane protein extraction and purification

  • Screen multiple buffer conditions with stabilizing agents (glycerol, specific lipids)

What purification strategy yields the highest purity Tmco5a protein?

A multi-step purification approach typically yields the best results:

  • Initial capture: Affinity chromatography using His-tag, similar to approaches used for other coiled-coil domain proteins

  • Intermediate purification: Ion exchange chromatography to separate based on charge differences

  • Polishing: Size exclusion chromatography to separate based on size and remove aggregates

  • For membrane-bound Tmco5a: Include appropriate detergents throughout purification to maintain protein stability

How should I design experiments to study Tmco5a membrane localization?

When designing experiments to study Tmco5a membrane localization, follow these principles:

  • Define your variables clearly: dependent variable (localization pattern) and independent variables (experimental conditions, mutations)

  • Formulate a specific hypothesis about Tmco5a localization

  • Design treatments that systematically manipulate relevant variables

  • Include proper controls (wild-type protein, known membrane proteins)

  • Use complementary approaches:

    • Fluorescent protein fusions for live-cell imaging

    • Subcellular fractionation followed by Western blotting

    • Immunofluorescence with validated antibodies

    • Electron microscopy for high-resolution localization

What control experiments are essential when studying Tmco5a dimerization?

Essential controls for Tmco5a dimerization studies include:

  • Positive control: A known dimerizing protein with similar properties

  • Negative control: A mutated version of Tmco5a with disrupted coiled-coil domain

  • Concentration-dependent controls: Perform experiments at multiple protein concentrations to rule out non-specific aggregation

  • Buffer composition controls: Test the effect of salt concentration, pH, and detergents on dimerization

  • Domain-specific controls: Compare full-length protein with isolated domains

How can I determine the optimal sample size for Tmco5a functional studies?

Determining sample size requires:

  • Estimating expected effect size based on preliminary data or similar studies

  • Determining desired statistical power (typically 0.8 or higher)

  • Setting significance level (typically α = 0.05)

  • Accounting for variability in your experimental system

  • Using power analysis software or formulas to calculate required sample size

For cell-based assays, at least three independent biological replicates with multiple technical replicates per condition are typically required for statistical validity .

How can I investigate if Tmco5a forms homodimers through its coiled-coil domain?

To investigate Tmco5a homodimerization via its coiled-coil domain:

  • Analytical gel filtration: Compare elution profiles of full-length protein versus constructs lacking the coiled-coil domain

  • Fluorescence Resonance Energy Transfer (FRET): Create fusion proteins with fluorescent proteins attached to the coiled-coil domain and measure energy transfer between proteins in close proximity

  • Cross-linking experiments followed by SDS-PAGE analysis

  • Mutation analysis: Introduce point mutations in key residues of the coiled-coil domain and assess their effect on dimerization

  • CD spectroscopy to confirm the α-helical structure of the isolated coiled-coil domain

What techniques can determine the orientation of the coiled-coil domain in Tmco5a dimers?

To determine coiled-coil orientation in dimers:

  • FRET analysis with specifically positioned fluorophores, similar to approaches used with other coiled-coil proteins

  • Cross-linking mass spectrometry to identify residues in close proximity

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR)

  • X-ray crystallography or cryo-EM of the purified protein

  • Computational modeling validated by experimental constraints

How can I assess if phospholipid binding contributes to Tmco5a membrane association?

To assess phospholipid binding's role in membrane association:

  • Protein-lipid overlay assays: Test binding of purified Tmco5a to membranes containing different phospholipids

  • Liposome binding assays with varying lipid compositions

  • Mutagenesis of potential lipid-binding sites followed by localization studies

  • Fluorescence-based binding assays (such as FRET or fluorescence anisotropy)

  • Surface plasmon resonance (SPR) to measure binding kinetics to specific lipids

What approaches can help resolve contradictory data regarding Tmco5a function?

When faced with contradictory data:

  • Validate reagents: Confirm antibody specificity, construct integrity, and cell line identity

  • Use multiple methodological approaches to address the same question

  • Systematically vary experimental conditions to identify context-dependent effects

  • Consider post-translational modifications or isoform-specific functions

  • Test function in multiple cell types or tissues

  • Design experiments with appropriate statistical power to detect effects

  • Perform blinded analyses to minimize bias

How can I investigate potential interaction partners of Tmco5a?

To identify Tmco5a interaction partners:

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screening with the coiled-coil domain as bait

  • Proximity labeling (BioID, APEX) in relevant cellular compartments

  • Pull-down assays using purified Tmco5a as bait

  • Crosslinking followed by immunoprecipitation and mass spectrometry

  • Mammalian two-hybrid assays for specific candidate interactions

What knockout/knockdown approaches are most effective for studying Tmco5a function?

For effective knockout/knockdown studies:

  • CRISPR-Cas9 for complete gene knockout:

    • Design multiple guide RNAs targeting early exons

    • Screen clones by sequencing and Western blot

    • Generate rescue lines expressing wild-type Tmco5a

  • RNAi approaches for temporary knockdown:

    • Use multiple siRNA sequences to confirm specificity

    • Validate knockdown efficiency by qPCR and Western blot

    • Include scrambled siRNA controls

  • Conditional knockout systems for developmental studies:

    • Cre-loxP systems for tissue-specific deletion

    • Tet-inducible systems for temporal control

  • Design proper experimental controls and randomize treatment groups to minimize bias

How can I develop a high-throughput screen to identify modulators of Tmco5a function?

To develop a high-throughput screen:

  • Define a clear, measurable endpoint related to Tmco5a function

  • Develop a robust assay with:

    • High signal-to-noise ratio

    • Low variability between replicates

    • Z' factor >0.5 to ensure assay quality

  • Include positive and negative controls on each plate

  • Optimize cell density, reagent concentrations, and incubation times

  • Validate hits with concentration-response curves and secondary assays

  • Use appropriate statistical methods for data analysis

What strategies can overcome challenges in generating Tmco5a-specific antibodies?

To generate specific antibodies:

  • Choose unique epitopes by analyzing sequence conservation:

    • Target regions unique to Tmco5a

    • Avoid transmembrane regions

    • Consider using the coiled-coil domain if sufficiently unique

  • Use multiple immunization strategies:

    • Peptide antigens for specific epitopes

    • Recombinant protein fragments for conformational epitopes

  • Validate antibody specificity:

    • Test in cells with Tmco5a knockout

    • Perform peptide competition assays

    • Compare multiple antibodies targeting different epitopes

  • Purify antibodies to improve specificity:

    • Affinity purification against the immunizing antigen

    • Negative selection against related proteins

How can structure-function analysis inform therapeutic targeting of Tmco5a?

For structure-function analysis leading to therapeutic targeting:

  • Identify critical functional domains through:

    • Systematic mutation analysis

    • Domain deletion studies

    • Chimeric protein approaches

  • Determine essential binding interfaces:

    • Map dimerization interfaces in the coiled-coil domain

    • Identify sites of interaction with binding partners

    • Characterize membrane association determinants

  • Develop screening strategies:

    • Virtual screening targeting specific binding pockets

    • Fragment-based approaches for novel chemical matter

    • Peptide inhibitors based on coiled-coil interaction surfaces

  • Design validation experiments with appropriate controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.