Tmco5a, or transmembrane and coiled-coil domain-containing protein 5A, is a protein-coding gene . It is predicted to be located in the membrane .
TMCO5A is involved in several pathways and has different roles, with some functions cooperated with other proteins and some acted by TMCO5A itself .
TMCO5A directly interacts with proteins and molecules, as detected by methods such as yeast two-hybrid, co-IP, and pull-down assays . TMCO5A has 998 functional associations with biological entities spanning 8 categories: molecular profile, organism, functional term, phrase or reference, disease, phenotype or trait, chemical, structural feature, cell line, cell type or tissue, gene, protein, or microRNA .
Recombinant Full Length Mouse Transmembrane And Coiled-Coil Domain-Containing Protein 5A(Tmco5A) Protein, His-Tagged, is a recombinant protein with a Full Length (1-303) amino acid sequence .
AA Sequence: MEEQKENQLDYESEKMEILRLAQSKKNIISLNMDLERDMQRIDEANQELLLEIQEKENEI QRLEHEITQTGNPAEDEEWEKENYTVMEREQALQELEEETARLERKNETLVHSISELQRK LTRKSQKVIRYEQGDLETTPEESKVKLQQLESSCADQEKELGKIMEDYVFVSQLCEDQAL CIKKYQEALKRIEEELETGYLEREVSKVLSMDSERERSTSLNKMDGFISKGALRFSKSIF RSLLFSTLFFIRLLGYLIFHLSFINPDLLVNALPKILSRDVLWKLRCFLFPSLTLETEDM LPH
TMCO5A expression can be affected by various chemicals :
A study identified a variant in the TMCO5A gene associated with total body bone mineral density (TB-BMD) :
| Chromosome | Position | SNP | Alleles | Frequency | Beta | P-value | Sample Size |
|---|---|---|---|---|---|---|---|
| 15 | 38340874 | rs12442242 | A/G | 0.85 | -0.051 | 4.94 × 10^{-10} | 66,403 |
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Tag type is determined during production. To request a specific tag, please inform us; we will prioritize its development.
Transmembrane and coiled-coil domain-containing protein 5A (Tmco5a) is characterized by its transmembrane regions that anchor it to cellular membranes and its coiled-coil domains that mediate protein-protein interactions. Similar to other proteins with coiled-coil modules, the coiled-coil domain in Tmco5a likely forms α-helical structures that intertwine to create stable dimers or oligomers . The protein may function in membrane targeting and protein complex formation, similar to other transmembrane proteins with coiled-coil domains.
Coiled-coil domains typically mediate protein dimerization or oligomerization, which is essential for protein function. As demonstrated with other proteins containing coiled-coil domains, these structures can be responsible for both homodimerization and membrane association . In the case of Tmco5a, the coiled-coil domain likely serves as a critical mediator of protein-protein interactions while also potentially contributing to membrane localization.
Several techniques can verify functional coiled-coil domains:
Circular Dichroism (CD) spectroscopy to confirm α-helical secondary structure with characteristic minima at 207 and 222 nm
Analytical gel filtration to determine oligomerization state
Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to determine absolute molecular weight of complexes
Site-directed mutagenesis of key residues within the predicted coiled-coil region to disrupt dimerization
For transmembrane proteins like Tmco5a, considering the optimal expression system is crucial:
| Expression System | Advantages | Disadvantages | Best For |
|---|---|---|---|
| E. coli | Cost-effective, high yield, rapid growth | May form inclusion bodies, lacks post-translational modifications | Soluble domains, preliminary studies |
| Mammalian cells (HEK293, CHO) | Native post-translational modifications, proper folding | Higher cost, lower yield, slower | Full-length protein, functional studies |
| Insect cells | High expression levels, post-translational modifications | Moderate cost, requires baculovirus | Compromise between yield and authenticity |
| Cell-free systems | Rapid, avoids toxicity issues | Limited scale, expensive | Difficult-to-express constructs |
The choice depends on your downstream applications and whether you need the full-length protein or specific domains.
Transmembrane proteins often present solubility challenges. Consider these strategies:
Express only the soluble domains (e.g., only the coiled-coil domain) for interaction studies
Use fusion tags that enhance solubility (MBP, SUMO, thioredoxin) similar to approaches used with other coiled-coil containing proteins
Optimize expression conditions: lower temperature (16-20°C), reduced inducer concentration
For full-length protein, use appropriate detergents for membrane protein extraction and purification
Screen multiple buffer conditions with stabilizing agents (glycerol, specific lipids)
A multi-step purification approach typically yields the best results:
Initial capture: Affinity chromatography using His-tag, similar to approaches used for other coiled-coil domain proteins
Intermediate purification: Ion exchange chromatography to separate based on charge differences
Polishing: Size exclusion chromatography to separate based on size and remove aggregates
For membrane-bound Tmco5a: Include appropriate detergents throughout purification to maintain protein stability
When designing experiments to study Tmco5a membrane localization, follow these principles:
Define your variables clearly: dependent variable (localization pattern) and independent variables (experimental conditions, mutations)
Design treatments that systematically manipulate relevant variables
Include proper controls (wild-type protein, known membrane proteins)
Use complementary approaches:
Fluorescent protein fusions for live-cell imaging
Subcellular fractionation followed by Western blotting
Immunofluorescence with validated antibodies
Electron microscopy for high-resolution localization
Essential controls for Tmco5a dimerization studies include:
Positive control: A known dimerizing protein with similar properties
Negative control: A mutated version of Tmco5a with disrupted coiled-coil domain
Concentration-dependent controls: Perform experiments at multiple protein concentrations to rule out non-specific aggregation
Buffer composition controls: Test the effect of salt concentration, pH, and detergents on dimerization
Domain-specific controls: Compare full-length protein with isolated domains
Determining sample size requires:
Estimating expected effect size based on preliminary data or similar studies
Determining desired statistical power (typically 0.8 or higher)
Setting significance level (typically α = 0.05)
Accounting for variability in your experimental system
Using power analysis software or formulas to calculate required sample size
For cell-based assays, at least three independent biological replicates with multiple technical replicates per condition are typically required for statistical validity .
To investigate Tmco5a homodimerization via its coiled-coil domain:
Analytical gel filtration: Compare elution profiles of full-length protein versus constructs lacking the coiled-coil domain
Fluorescence Resonance Energy Transfer (FRET): Create fusion proteins with fluorescent proteins attached to the coiled-coil domain and measure energy transfer between proteins in close proximity
Cross-linking experiments followed by SDS-PAGE analysis
Mutation analysis: Introduce point mutations in key residues of the coiled-coil domain and assess their effect on dimerization
CD spectroscopy to confirm the α-helical structure of the isolated coiled-coil domain
To determine coiled-coil orientation in dimers:
FRET analysis with specifically positioned fluorophores, similar to approaches used with other coiled-coil proteins
Cross-linking mass spectrometry to identify residues in close proximity
Site-directed spin labeling combined with electron paramagnetic resonance (EPR)
X-ray crystallography or cryo-EM of the purified protein
Computational modeling validated by experimental constraints
To assess phospholipid binding's role in membrane association:
Protein-lipid overlay assays: Test binding of purified Tmco5a to membranes containing different phospholipids
Liposome binding assays with varying lipid compositions
Mutagenesis of potential lipid-binding sites followed by localization studies
Fluorescence-based binding assays (such as FRET or fluorescence anisotropy)
Surface plasmon resonance (SPR) to measure binding kinetics to specific lipids
When faced with contradictory data:
Validate reagents: Confirm antibody specificity, construct integrity, and cell line identity
Use multiple methodological approaches to address the same question
Systematically vary experimental conditions to identify context-dependent effects
Consider post-translational modifications or isoform-specific functions
Test function in multiple cell types or tissues
Design experiments with appropriate statistical power to detect effects
To identify Tmco5a interaction partners:
Co-immunoprecipitation followed by mass spectrometry
Yeast two-hybrid screening with the coiled-coil domain as bait
Proximity labeling (BioID, APEX) in relevant cellular compartments
Pull-down assays using purified Tmco5a as bait
Crosslinking followed by immunoprecipitation and mass spectrometry
Mammalian two-hybrid assays for specific candidate interactions
For effective knockout/knockdown studies:
CRISPR-Cas9 for complete gene knockout:
Design multiple guide RNAs targeting early exons
Screen clones by sequencing and Western blot
Generate rescue lines expressing wild-type Tmco5a
RNAi approaches for temporary knockdown:
Use multiple siRNA sequences to confirm specificity
Validate knockdown efficiency by qPCR and Western blot
Include scrambled siRNA controls
Conditional knockout systems for developmental studies:
Cre-loxP systems for tissue-specific deletion
Tet-inducible systems for temporal control
Design proper experimental controls and randomize treatment groups to minimize bias
To develop a high-throughput screen:
Define a clear, measurable endpoint related to Tmco5a function
Develop a robust assay with:
High signal-to-noise ratio
Low variability between replicates
Z' factor >0.5 to ensure assay quality
Include positive and negative controls on each plate
Optimize cell density, reagent concentrations, and incubation times
Validate hits with concentration-response curves and secondary assays
To generate specific antibodies:
Choose unique epitopes by analyzing sequence conservation:
Target regions unique to Tmco5a
Avoid transmembrane regions
Consider using the coiled-coil domain if sufficiently unique
Use multiple immunization strategies:
Peptide antigens for specific epitopes
Recombinant protein fragments for conformational epitopes
Validate antibody specificity:
Test in cells with Tmco5a knockout
Perform peptide competition assays
Compare multiple antibodies targeting different epitopes
Purify antibodies to improve specificity:
Affinity purification against the immunizing antigen
Negative selection against related proteins
For structure-function analysis leading to therapeutic targeting:
Identify critical functional domains through:
Systematic mutation analysis
Domain deletion studies
Chimeric protein approaches
Determine essential binding interfaces:
Develop screening strategies:
Virtual screening targeting specific binding pockets
Fragment-based approaches for novel chemical matter
Peptide inhibitors based on coiled-coil interaction surfaces