Recombinant Mouse Transmembrane and coiled-coil domain-containing protein 5B (Tmco5b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. To ensure a specific tag, please inform us during your order; we will prioritize its inclusion.
Synonyms
Tmco5b; Transmembrane and coiled-coil domain-containing protein 5B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmco5b
Target Protein Sequence
MEDAGQNPLDDEAEITEIPTLEAIKQNLKYLNSDLEKDLQRLDEANQILLRKIQKKEESI QSLERDIALSIGRVPERDDFNEILAQKETALKDLELESAKLEKKNKTLSKNVMELQKKIS KGLKNIASDPETLKKKVTEFKVKLQKSTESCAQQEKEIAKMESDYQSVFQLCEDQAHYIK KYQEILREMEKEKEVMLLEKEISKAQNDSSQVVKPGSTLVETIQSNMEKNIIKKQKRKFW LRHFRYLFFMVMIVIRLLGYVFFHLQYVNPDFLVDTLPMLMSRSSLKWLRDILFPFLTLE VEDVLPH
Uniprot No.

Target Background

Database Links
Protein Families
TMCO5 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the expression profile of Mouse Tmco5b?

Based on studies of the related family member TMCO5, expression appears to be highly tissue-specific:

  • Expression is predominantly in reproductive tissues, particularly in testis

  • TMCO5 is specifically expressed in elongating spermatids (step 9 to 12)

  • Expression begins around 4 weeks of age in mice, corresponding to the onset of spermiogenesis

  • Not detectable in epididymis, suggesting it's not a component of mature sperm

For Tmco5b specifically, gene expression database entries indicate expression patterns may differ from TMCO5, but detailed expression data is still emerging . When designing experiments, researchers should validate expression patterns through methods like qPCR, western blotting, and immunohistochemistry across multiple tissue types and developmental stages.

How can I generate recombinant Mouse Tmco5b protein for my research?

Based on established protocols for TMCO family proteins, the following methodology is recommended:

  • Cloning strategy:

    • PCR-amplify the coding region of Tmco5b from mouse testis cDNA

    • Use primers with appropriate restriction sites (e.g., NheI, HindIII)

    • Clone into a suitable expression vector (e.g., pRSET A for bacterial expression)

  • Expression system selection:

    • For bacterial expression: BL21(DE3) pLysS competent cells

    • For mammalian expression: CHO cells with an inducible system like Tet-on

  • Purification approach:

    • Metal affinity chromatography (e.g., TALON Metal Affinity chromatography)

    • Include a His-tag for easier purification

    • Consider protein-specific buffer optimization to maintain stability

Example PCR conditions for amplification:

  • Denaturing: 98°C for 10 sec

  • Annealing: 55°C for 5 sec

  • Extension: 72°C for 20 sec

  • 30 reaction cycles

What antibody options are available for detecting Mouse Tmco5b?

Currently, commercial antibodies for Tmco5b include:

  • Monoclonal antibodies:

    • Limited commercial availability; may require custom production

    • For custom development, consider immunizing rats with purified recombinant protein (300 μg with Freund's adjuvant)

  • Commercial options:

    • Verify specificity before use in critical experiments

    • Consider using siRNA knockdown controls to validate antibody specificity

  • Alternative detection methods:

    • Epitope tagging (His, FLAG, or HA) of recombinant Tmco5b

    • Commercial ELISA kits for detection in complex samples

When developing custom antibodies, screening should include both ELISA against recombinant protein and immunohistochemistry on relevant tissues (e.g., adult mouse testes sections) .

What are the recommended methods for validating Tmco5b knockdown experiments?

For effective knockdown validation:

  • siRNA approach:

    • Commercial siRNA products targeting Tmco5b are available

    • Design experiments with appropriate negative controls

  • CRISPR-based methods:

    • Double Nickase Plasmid systems offer improved specificity while maintaining high knockout efficiency

    • Target the Tmco5b genetic locus mapping to mouse chromosome 2 E4

  • Validation methods:

    • qRT-PCR to measure mRNA levels

    • Western blotting to confirm protein reduction

    • Immunocytochemistry/immunohistochemistry for tissue/cellular expression

  • Control selection:

    • Include scrambled siRNA or non-targeting gRNA controls

    • Use wild-type cells processed in parallel

    • Consider rescue experiments with expression of siRNA-resistant constructs

What approaches can be used to determine the subcellular localization of Mouse Tmco5b?

Based on studies of the related TMCO5 protein, several complementary approaches are recommended:

  • Immunofluorescence microscopy:

    • Use specific antibodies against Tmco5b

    • Include co-staining with organelle markers (e.g., β-tubulin for microtubules, ER markers, Golgi markers)

    • Consider super-resolution microscopy for precise localization

  • Cell fractionation and western blotting:

    • Separate cellular components (cytosol, membrane, nucleus)

    • Perform western blotting on fractions

    • Include markers for each fraction as controls

  • Recombinant expression systems:

    • Express fluorescently-tagged Tmco5b in relevant cell lines

    • Consider inducible expression systems like Tet-on for controlled expression

    • Study how Tmco5b distribution changes compared to organelle markers

From TMCO5 studies, researchers observed that the protein localizes to the manchette in spermatids and co-localizes with β-tubulin, suggesting association with microtubules . Similar approaches can be applied to Tmco5b with appropriate controls.

How can I investigate potential binding partners and protein interactions of Tmco5b?

To identify and validate protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against Tmco5b to pull down complexes

    • Analyze by mass spectrometry or western blotting

    • Include appropriate negative controls (IgG, irrelevant antibodies)

  • Proximity labeling approaches:

    • BioID or TurboID fusion with Tmco5b

    • APEX2 tagging for proximity-dependent biotinylation

    • Follow with streptavidin pulldown and mass spectrometry

  • Yeast two-hybrid screening:

    • Use the N-terminal coiled-coil domain as bait

    • Screen against testis cDNA library

    • Validate hits with secondary assays

  • Fluorescence resonance energy transfer (FRET):

    • Generate fluorescent protein fusions

    • Measure interactions in live cells

    • Quantify FRET efficiency to assess proximity

Based on TMCO5 studies, attention should be paid to potential interactions with microtubule components, vesicle transport machinery, and Golgi-associated proteins, as these have been implicated in the function of related family members .

What is the potential functional significance of Tmco5b in cellular processes?

While specific functions of Tmco5b require further investigation, insights from related proteins suggest several possible roles:

  • Vesicle trafficking:

    • TMCO5 appears to influence Golgi organization when expressed in CHO cells

    • The presence of domains similar to SNARE proteins suggests potential roles in membrane fusion events

  • Microtubule association:

    • Co-localization with β-tubulin suggests interaction with the cytoskeleton

    • Potential role in intracellular transport along microtubules

  • Calcium signaling pathways:

    • Other TMCO family members are implicated in calcium regulation

    • Consider investigating Tmco5b in calcium-dependent processes

Experimental approaches to investigate function include:

  • Gene knockout or knockdown followed by phenotypic analysis

  • Overexpression studies to observe gain-of-function effects

  • Structure-function analysis with domain deletion mutants

  • Calcium imaging in cells with modified Tmco5b expression

What are the considerations for using CRISPR-Cas9 to study Tmco5b function?

For effective CRISPR-based studies:

  • Guide RNA design:

    • Use Double Nickase approaches for enhanced specificity

    • Target functionally important domains (transmembrane or coiled-coil regions)

    • Validate guide RNA efficiency in cell lines before moving to animal models

  • Screening strategies:

    • Design PCR primers flanking the target site

    • Use T7 Endonuclease I assay or Sanger sequencing to detect mutations

    • Consider deep sequencing for comprehensive analysis of editing outcomes

  • Potential challenges:

    • Off-target effects that may affect related genes

    • Efficiency of homology-directed repair for knock-in experiments

    • Phenotypic validation in appropriate cell types expressing Tmco5b

  • Controls and validation:

    • Include multiple guide RNAs targeting different regions

    • Use rescue experiments with wild-type or mutant variants

    • Perform comprehensive off-target analysis

The TMCO5B Double Nickase Plasmid system available commercially offers improved specificity while maintaining high knockout efficiency, making it an attractive option for gene editing experiments .

How does Tmco5b expression relate to other genes in reproductive development and function?

Understanding the regulatory network:

  • Transcriptional regulation:

    • Based on TMCO5 studies, Tmco5b may be under strict developmental regulation

    • Expression potentially beginning at specific stages of spermatogenesis

    • Consider analyzing promoter regions for reproductive tissue-specific elements

  • Co-expression analysis:

    • Perform RNA-seq on reproductive tissues at different developmental stages

    • Identify genes with similar expression patterns to Tmco5b

    • Create co-expression networks to predict functional relationships

  • Regulatory mechanisms:

    • Investigate post-transcriptional regulation (RNA-binding proteins, miRNAs)

    • Studies of TMCO5 suggest potential translational repression mechanisms in developing germ cells

  • Comparative analysis across species:

    • Examine conservation of expression patterns and regulatory elements

    • Identify species-specific adaptations in reproductive tissue expression

GeneExpression PatternPotential Functional Relationship
TMCO5Elongating spermatids (step 9-12)Similar localization and domain structure
TMCO1Upregulated in medulloblastomaER calcium channel, different function
TMCO6Variable expressionUnknown relationship to Tmco5b

What are the key controls needed for Tmco5b localization studies?

For rigorous localization studies:

  • Antibody validation controls:

    • Pre-immune serum or isotype controls

    • Peptide competition assays to confirm specificity

    • Cells or tissues lacking Tmco5b expression

    • siRNA knockdown to validate antibody specificity

  • Co-localization controls:

    • Include markers for relevant cellular structures (Golgi, ER, microtubules)

    • Quantify co-localization using appropriate statistical measures

    • Include proteins known not to co-localize as negative controls

  • Expression system considerations:

    • Control for expression levels to avoid artifacts from overexpression

    • Use inducible systems (e.g., Tet-on) to regulate expression levels

    • Compare multiple cell types to account for cell-specific factors

  • Imaging controls:

    • Include no-primary antibody controls

    • Account for channel bleed-through in multi-color experiments

    • Use appropriate resolution for subcellular structures

Based on TMCO5 studies, researchers should be particularly attentive to potential differences in localization patterns depending on expression systems and cell types used .

How can I design experiments to investigate Tmco5b's potential role in calcium signaling?

Given that some TMCO family members are implicated in calcium regulation :

  • Expression analysis in calcium-responsive tissues:

    • Verify Tmco5b expression in tissues with active calcium signaling

    • Compare expression levels under conditions that alter calcium homeostasis

  • Calcium imaging approaches:

    • Use fluorescent calcium indicators (Fluo-4, Fura-2) in cells with modified Tmco5b levels

    • Measure calcium dynamics after stimulation of calcium release

    • Quantify parameters such as peak amplitude, duration, and recovery kinetics

  • Electrophysiological methods:

    • Patch-clamp recording to measure calcium currents

    • Investigate changes in channel properties with Tmco5b modification

  • Biochemical interaction studies:

    • Screen for interactions with known calcium channel components

    • Investigate potential calcium-binding motifs within Tmco5b sequence

    • Examine calcium-dependent protein modifications or interactions

When designing these experiments, consider that TMCO1 functions as an ER calcium channel , suggesting potential calcium-related functions for other family members including Tmco5b.

What methodological approaches would best determine if Tmco5b functions in vesicle transport?

Based on evidence from TMCO5 studies suggesting roles in vesicle transport along manchette microtubules :

  • Live cell imaging of vesicle dynamics:

    • Express fluorescently tagged Tmco5b alongside vesicle markers

    • Use time-lapse microscopy to track vesicle movement

    • Quantify parameters such as velocity, directionality, and processivity

  • Functional transport assays:

    • Monitor transport of cargo proteins in cells with altered Tmco5b levels

    • Measure accumulation of secreted proteins in the culture medium

    • Analyze glycosylation patterns as indicators of ER-to-Golgi transport

  • Structural studies of vesicle association:

    • Immunoelectron microscopy to visualize Tmco5b on vesicles

    • Vesicle isolation and proteomic analysis

    • Reconstruct 3D models of Tmco5b-associated vesicles

  • Assessing interactions with transport machinery:

    • Investigate binding to motor proteins (kinesins, dyneins)

    • Examine associations with adaptor complexes

    • Test the effects of microtubule-disrupting drugs on Tmco5b localization

The presence of SNARE-like domains (Syntaxin_2, Synaptobrevin) and a Vac_Fusion domain in the related TMCO5 suggests potential roles in membrane fusion events that could be investigated in Tmco5b as well .

How can I properly evaluate changes in Tmco5b expression across different experimental conditions?

For accurate expression analysis:

  • RNA-level quantification:

    • qRT-PCR with validated primer sets

    • RNA-seq for genome-wide expression analysis

    • Include multiple reference genes for normalization

    • Consider transcript variants and splicing events

  • Protein-level quantification:

    • Western blotting with appropriate loading controls

    • Quantitative proteomics (SILAC, TMT labeling)

    • ELISA for quantitative measurement in complex samples

    • Consider post-translational modifications that might affect detection

  • Single-cell approaches:

    • Single-cell RNA-seq to capture cellular heterogeneity

    • Immunofluorescence with quantitative image analysis

    • Flow cytometry for high-throughput single-cell protein quantification

  • Temporal considerations:

    • Time-course experiments to capture dynamic changes

    • Account for cell cycle effects on expression

    • Consider developmental timing based on TMCO5 expression patterns

When analyzing expression data, use appropriate statistical methods and consider biological significance alongside statistical significance.

How can I overcome challenges in producing soluble recombinant Tmco5b protein?

As a transmembrane protein, Tmco5b may present solubility challenges:

  • Expression strategy modifications:

    • Express only the soluble domains (e.g., N-terminal coiled-coil domain)

    • Use fusion partners to enhance solubility (MBP, SUMO, TRX)

    • Test multiple expression temperatures (16°C, 25°C, 37°C)

    • Optimize induction conditions (IPTG concentration, induction time)

  • Extraction and solubilization approaches:

    • Test different detergents for membrane protein extraction

    • Use mild detergents (DDM, CHAPS) for initial solubilization

    • Consider native membrane mimetics (nanodiscs, liposomes)

    • Implement stepwise solubilization protocols

  • Purification strategy optimization:

    • Include detergents throughout the purification process

    • Test various buffer compositions and pH values

    • Consider on-column refolding for inclusion body purification

    • Use size exclusion chromatography as a final polishing step

Based on approaches used for other transmembrane proteins, careful optimization of these parameters can significantly improve yield and quality of recombinant Tmco5b.

What strategies can address non-specific binding issues in Tmco5b antibody applications?

For improved antibody specificity:

  • Antibody purification approaches:

    • Affinity purification against recombinant Tmco5b

    • Negative selection against related family members

    • Consider using monoclonal antibodies for increased specificity

  • Blocking optimization:

    • Test different blocking reagents (BSA, milk, commercial blockers)

    • Optimize blocking time and temperature

    • Include competing peptides to reduce non-specific binding

  • Immunostaining protocol modifications:

    • Adjust antibody concentration and incubation conditions

    • Optimize fixation and permeabilization methods

    • Include appropriate washing steps with detergents

  • Validation with genetic approaches:

    • Use tissues/cells from knockout models as negative controls

    • Include siRNA knockdown samples as specificity controls

    • Consider epitope-tagged constructs for validation

When troubleshooting specificity issues, systematic optimization of each protocol step and inclusion of appropriate controls is essential for reliable results.

How can I analyze complex phenotypes resulting from Tmco5b manipulation?

For comprehensive phenotypic analysis:

  • Multi-parameter cellular assays:

    • High-content imaging for morphological analysis

    • Flow cytometry for quantitative multi-parameter assessment

    • Live-cell imaging to capture dynamic processes

  • Tissue-specific analysis in model systems:

    • Histological examination of tissues expressing Tmco5b

    • Electron microscopy for ultrastructural analysis

    • Functional assays relevant to the tissue type

  • Molecular profiling approaches:

    • Transcriptomics to identify affected pathways

    • Proteomics to detect changes in protein expression and modification

    • Metabolomics to assess downstream functional impacts

  • Integrative data analysis:

    • Apply systems biology approaches to integrate multiple data types

    • Use pathway analysis tools to identify affected networks

    • Compare phenotypes to related gene manipulations

Based on TMCO5's expression in reproductive tissues, particular attention should be paid to effects on spermatogenesis, cellular architecture, and associated developmental processes .

What are the common pitfalls in interpreting Tmco5b localization and how can they be avoided?

To ensure accurate localization interpretation:

  • Technical artifacts awareness:

    • Distinguish genuine signal from fixation artifacts

    • Control for antibody cross-reactivity with related proteins

    • Consider effects of overexpression on localization patterns

    • Account for cell-specific differences in protein distribution

  • Resolution limitations:

    • Be aware of optical resolution limits in standard microscopy

    • Use super-resolution techniques for precise colocalization studies

    • Consider 3D analysis rather than single optical sections

  • Dynamic localization considerations:

    • Examine localization under various cellular conditions

    • Perform time-lapse imaging to capture protein trafficking

    • Consider cell cycle-dependent changes in localization

  • Quantitative approach:

    • Use quantitative colocalization metrics rather than visual assessment

    • Perform statistical analysis of localization across multiple cells

    • Report variability in localization patterns within populations

Studies of TMCO5 revealed differences in localization depending on expression system and cell type, highlighting the importance of using physiologically relevant models and appropriate controls .

What emerging technologies could advance our understanding of Tmco5b function?

Several cutting-edge approaches hold promise:

  • Cryo-electron microscopy:

    • Determine high-resolution structure of Tmco5b

    • Visualize complexes with interaction partners

    • Compare with structures of related family members

  • Genome-wide CRISPR screens:

    • Identify genetic interactions with Tmco5b

    • Discover synthetic lethal relationships

    • Map functional pathways connected to Tmco5b

  • Spatial transcriptomics and proteomics:

    • Map Tmco5b expression within complex tissues

    • Correlate with expression of functionally related genes

    • Identify tissue microenvironments influencing expression

  • Organoid and advanced cell culture models:

    • Study Tmco5b in physiologically relevant 3D systems

    • Investigate developmental regulation in tissue-like contexts

    • Model disease states with altered Tmco5b function

These approaches could overcome current limitations in understanding Tmco5b's role in cellular processes and tissue development.

How might understanding Tmco5b function contribute to reproductive biology research?

Based on expression patterns of related family members:

  • Spermatogenesis and male fertility:

    • Investigate Tmco5b's role in sperm development and maturation

    • Examine potential contributions to manchette function and sperm head shaping

    • Assess impact on male fertility in knockout models

  • Evolutionary perspectives:

    • Compare Tmco5b function across species with different reproductive strategies

    • Investigate selective pressures on Tmco5 family genes

    • Examine species-specific adaptations in expression and function

  • Translational applications:

    • Potential relevance to male infertility diagnosis

    • Possible targets for contraceptive development

    • Biomarker applications in reproductive health

  • Developmental biology insights:

    • Contribution to understanding specialized cytoskeletal structures

    • Insights into tissue-specific vesicle transport mechanisms

    • Developmental regulation of protein expression in specialized cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.