Recombinant Mouse Transmembrane and coiled-coil domains protein 2 (Tmcc2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your reconstitution.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmcc2; Kiaa0481; Transmembrane and coiled-coil domains protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-706
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmcc2
Target Protein Sequence
MKRCKSDELQQQQGEEDGAGMEDAACLLPGADLRHGEASSANSAGGPTSDAGAAVAPNPG PRSKPPDLKKIQQLSEGSMFGHGLKHLFHSRRRSREREHQASQEAQQQQQQQGLSDQDSP DEKERSPEMHRVSYAVSLHDLPARPTAFNRVLQQIRSRPSIKRGASLHSSGGSGGRRAKS SSLEPQRGSPHLLRKAPQDSSLAAILHQHQGRPRSSSTTDTALLLADGSSAYLLAEEAES IGDKGDKGDLVALSLPSGPGHGDSDGPISLDVPDGAPDPQRTKAAIEHLHQKILKITEQI KIEQEARDDNVAEYLKLANNADKQQVSRIKQVFEKKNQKSAQTIAQLHKKLEHYRRRLKE IEQNGPSRQPKDVLRDMQQGLKDVGANMRAGISGFGGGVVEGVKGSLSGLSQATHTAVVS KPREFASLIRNKFGSADNIAHLKDPMEDGPPEEAARALSGSATLVSSPKYGSDDECSSAS ASSAGAGSNSGAGPGGALGSPRSNTLYGAPGNLDTLLEELREIKEGQSHLEDSMEDLKTQ LQRDYTYMTQCLQEERYRYERLEEQLNDLTELHQNEMTNLKQELASMEEKVAYQSYERAR DIQEAVESCLTRVTKLELQQQQQQVVQLEGVENANARALLGKFINVILALMAVLLVFVST IANFITPLMKTRLRITSTALLLLVLFLLWKHWASLTYLLEHVLLPS
Uniprot No.

Target Background

Function
May be involved in regulating the proteolytic processing of amyloid precursor protein (APP), potentially implicating APOE.
Database Links
Protein Families
TEX28 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane and Coiled-Coil Domains Protein 2 (Tmcc2)?

Tmcc2 is an ER-residing protein whose physiological function has only recently begun to be elucidated through knockout studies. It belongs to the TMCC protein family and is characterized by its transmembrane and coiled-coil structural domains. The protein exists in multiple isoforms, with the longest isoform having a theoretical molecular mass of approximately 77 kDa, though it typically appears as an 85-90 kDa band on western blots . Functionally, Tmcc2 plays important roles in ER stress regulation, and its loss leads to elevated ER stress and subsequent cellular dysfunction in various tissues, particularly in auditory hair cells .

Where is Tmcc2 expressed in mice?

Tmcc2 shows tissue-specific expression patterns in mice. In situ hybridization studies have revealed that Tmcc2 is specifically expressed in the inner and outer hair cells (OHCs) of the mouse cochlea, with expression detectable by postnatal day 7 (P7) . It is also expressed in the utricle and saccule of the vestibular system, albeit at much lower levels compared to the cochlea . Beyond the inner ear, Tmcc2 expression has been detected in brain tissue, particularly in neurons with a somatodendritic pattern . Additionally, the involvement of Tmcc2 in erythropoiesis suggests expression in hematopoietic tissues, though this has been less extensively characterized .

What phenotypes are observed in Tmcc2 knockout mice?

Tmcc2 knockout mice exhibit several distinct phenotypes:

  • Auditory dysfunction: Homozygous Tmcc2 knockout mice demonstrate congenital hearing loss without obvious balance deficits, consistent with the higher expression of Tmcc2 in cochlear versus vestibular hair cells .

  • Erythropoietic abnormalities: Newborn Tmcc2 knockout mice on a C57BL/6 background are notably pale in color, and more than half die soon after birth, suggesting critical roles in erythropoiesis .

  • Hair cell degeneration: Progressive loss of outer hair cells is observed in Tmcc2 knockout mice, with inner hair cells showing better preservation, despite comparable expression levels of Tmcc2 in both cell types .

  • Genetic background effects: Interestingly, when maintained in a C57BL/6 and CBA/J mixed background, Tmcc2 knockout mice show normal coloration and survival rates, though hearing deficits persist, indicating genetic modifiers of the erythropoietic phenotype .

How is Tmcc2 related to neurodegenerative disorders?

Tmcc2 has significant associations with Alzheimer's disease (AD) pathology through multiple mechanisms. It forms complexes with amyloid protein precursor (APP) in both human cells and in rat brain . Additionally, Tmcc2 binds to apolipoprotein E (apoE), with differential affinity for apoE isoforms - the AD-associated apoE4 showing stronger effects than the more common apoE3 .

Immunohistochemical studies have demonstrated that Tmcc2 immunoreactivity is associated with dense-cored plaques characteristic of AD pathology . In Down syndrome AD, researchers have observed distinctive TMCC2-immunoreactive pathological features that differ morphologically from those in late-onset and familial AD cases . These associations suggest that Tmcc2 may represent a molecular link between apoE status and APP processing in dementia pathogenesis .

How can Tmcc2 knockout mice be generated using CRISPR/Cas9?

Generation of Tmcc2 knockout mice using CRISPR/Cas9 technology can be accomplished through two distinct approaches demonstrated in recent literature:

  • Exon deletion approach: Researchers have successfully generated Tmcc2 knockout mice by designing two small guide RNAs (sgRNAs) targeting sequences flanking exon 3 . This strategy resulted in a 2102 bp deletion removing the entire exon 3 (941 bp), causing a premature translational stop in all three Tmcc2 transcription variants. The deletion was confirmed through genotyping PCR and Sanger sequencing .

  • Frameshift mutation approach: An alternative strategy involves introducing a smaller deletion (11 nucleotides) in the coding sequence (c.835_845del11b) that creates a premature stop codon (p.279X) in all Tmcc2 isoforms . This approach may be preferable when a complete gene inactivation is desired without removing large genomic regions.

For validation of successful knockout, researchers should employ a combination of:

  • RT-PCR to detect truncated transcripts

  • Western blotting using anti-Tmcc2 antibodies to confirm protein absence

  • In situ hybridization with probes corresponding to deleted regions to verify tissue-specific expression patterns

What molecular mechanisms underlie Tmcc2's role in ER stress regulation?

Tmcc2 appears to function as a critical regulator of ER homeostasis, with its absence leading to elevated ER stress. The molecular pathways involved include:

  • Unfolded protein response (UPR) activation: Loss of Tmcc2 in knockout mice shows increased expression of key ER stress markers, including BiP/GRP78, CHOP, and spliced XBP1 . These markers represent activation of all three main UPR pathways mediated by ER stress sensors: inositol-requiring enzyme 1α (IRE1α), PKR-like ER kinase (PERK), and activating transcription factor 6α (ATF6α) .

  • Compensatory mechanisms: When Tmcc2 is knocked down using siRNA approaches, expression of related family members Tmcc1 and Tmcc3 is elevated, suggesting potential functional compensation within the TMCC protein family . This indicates overlapping but non-redundant functions among TMCC proteins in ER homeostasis.

  • Cell-specific vulnerability: Despite comparable expression levels of Tmcc2 in both inner and outer hair cells, OHCs show greater susceptibility to degeneration in Tmcc2 knockout mice . This differential vulnerability likely reflects intrinsic differences in stress response capabilities rather than Tmcc2 expression patterns, as OHCs are generally more sensitive to genetic or environmental insults .

Researchers investigating these mechanisms should consider employing both in vivo (knockout mice) and in vitro (siRNA knockdown in appropriate cell lines like OC-1 cells) approaches to fully characterize the ER stress response pathways affected by Tmcc2 deficiency .

How does Tmcc2 interact with APP and apoE in the context of Alzheimer's disease?

The interaction between Tmcc2, APP, and apoE represents a complex relationship with significant implications for Alzheimer's disease pathogenesis:

  • Tmcc2-APP complex formation: Tmcc2 forms physical complexes with APP in transfected human cells and in rat brain, where a substantial fraction of Tmcc2 exists in association with APP . This interaction is evolutionarily conserved, as the Drosophila orthologue of Tmcc2 also interacts with the APP family .

  • ApoE isoform-dependent effects: Tmcc2 shows binding to apolipoprotein E, with differential effects depending on the apoE isoform. In the presence of Tmcc2, apoE4 (the greatest genetic risk factor for late-onset AD) shows a larger effect on amyloid-beta (Aβ) production than the more common apoE3 isoform .

  • Influence on APP processing: Tmcc2 mediates an apoE-dependent increase in Aβ secretion from cells expressing mutant forms of APP (such as the Swedish variant K595N, M596L) and from C-terminal fragments of APP generated following BACE cleavage .

  • Association with AD pathology: Immunohistochemical studies reveal that Tmcc2 immunoreactivity is associated with dense-cored plaques characteristic of AD pathology and additionally found in thread-like pathological features in Down syndrome AD .

  • Protein isoform variations: Western blots of human brain extracts show that human brain-derived Tmcc2 exists as at least three isoforms, the relative abundance of which varies between brain regions (temporal gyrus vs. cerebellum) and is influenced by APOE genotype and/or dementia status .

These interactions suggest that Tmcc2 may represent a molecular link between two key factors in AD pathogenesis: apoE status and APP processing. Researchers studying these relationships should employ co-immunoprecipitation, proximity ligation assays, and immunohistochemical colocalization studies to further characterize these interactions .

What techniques can be used to detect and characterize Tmcc2 expression?

Several complementary techniques have been employed to detect and characterize Tmcc2 expression:

What are the key considerations when studying Tmcc2 knockout models?

Researchers working with Tmcc2 knockout models should consider several important factors:

  • Genetic background effects: The phenotype of Tmcc2 knockout mice varies significantly depending on genetic background. On a pure C57BL/6 background, knockout mice show pale coloration and high postnatal mortality, while on a mixed C57BL/6 and CBA/J background, these phenotypes are absent despite persistent hearing deficits . This suggests genetic modifiers influence some aspects of the Tmcc2 knockout phenotype.

  • Knockout validation methods: Comprehensive validation requires multiple approaches:

    • Genotyping PCR and Sanger sequencing to confirm the intended genetic modification

    • RT-PCR to verify transcript alterations

    • Western blotting to confirm protein absence

    • In situ hybridization to verify tissue-specific expression patterns

  • Compensation by related proteins: Knockdown or knockout of Tmcc2 leads to upregulation of related family members Tmcc1 and Tmcc3, suggesting compensatory mechanisms that may partially mask phenotypes . Researchers should quantify expression of all TMCC family members when analyzing knockout effects.

  • Cell-type specific vulnerabilities: Despite similar expression levels of Tmcc2 in inner and outer hair cells, these cell types show differential susceptibility to Tmcc2 deficiency, with OHCs being more severely affected . This highlights the importance of examining multiple cell types within a tissue rather than assuming uniform effects.

  • Consideration of complete versus conditional knockouts: Complete gene inactivation provides comprehensive phenotypic information but may miss aspects of Tmcc2 function due to early lethality in some genetic backgrounds . Conditional knockouts using tissue-specific promoters may be necessary for studying functions in specific tissues without the confounding effects of systemic deficiency.

How should knockdown experiments for Tmcc2 be designed and validated?

For effective Tmcc2 knockdown experiments, researchers should consider:

  • Cell line selection: Expression levels of Tmcc2 vary significantly across cell lines. RT-PCR screening has shown that while most examined cell lines express Tmcc1, only certain cell lines (such as OC-1) show high expression of Tmcc2, making them suitable models for knockdown studies .

  • siRNA design and validation: Multiple siRNAs should be tested to identify those that:

    • Efficiently knockdown Tmcc2 expression

    • Minimize off-target effects

    • Have minimal effects on the expression of related family members (Tmcc1 and Tmcc3) to avoid confounding by compensatory mechanisms

  • Validation of knockdown efficiency:

    • RT-PCR to quantify reduction in Tmcc2 mRNA levels

    • Western blotting to confirm protein reduction

    • Monitoring expression changes in Tmcc1 and Tmcc3 to detect compensation

  • Functional readouts: Appropriate assays should be selected based on the specific aspect of Tmcc2 function being studied:

    • For ER stress studies: RT-PCR and immunostaining for ER stress markers (BiP/GRP78, CHOP, XBP1 splicing)

    • For interactions with APP/apoE: Co-immunoprecipitation, Aβ secretion assays

    • For effects on erythropoiesis: Erythroid differentiation markers, cell viability assays

  • Rescue experiments: To confirm specificity of observed phenotypes, knockdown experiments should be complemented with rescue studies using:

    • Overexpression of siRNA-resistant Tmcc2 constructs

    • Possibly testing whether related family members (Tmcc1 or Tmcc3) can compensate functionally when overexpressed

How should researchers interpret changes in molecular markers associated with Tmcc2 deficiency?

Interpretation of molecular changes in Tmcc2-deficient models requires careful consideration of several factors:

  • ER stress marker alterations: Elevated expression of BiP/GRP78, CHOP, and spliced XBP1 in Tmcc2 knockout mice or knockdown cells indicates activation of unfolded protein response pathways . These changes should be interpreted in the context of:

    • The timeline of marker activation (early vs. late UPR response)

    • Cell-type specific responses, as different cell populations may show variable UPR activation

    • Potential secondary effects from compensatory mechanisms

  • Compensation by related proteins: Upregulation of Tmcc1 and Tmcc3 following Tmcc2 knockdown suggests partial functional redundancy within this protein family . Researchers should:

    • Quantify all TMCC family members when analyzing Tmcc2 deficiency

    • Consider the relative expression levels and potential functional overlap

    • Interpret phenotypes in light of possible compensation that may mask certain aspects of Tmcc2 function

  • Cell death pathways: When analyzing progressive hair cell loss in Tmcc2 knockout mice, researchers should distinguish between:

    • Direct effects of ER stress-induced apoptosis

    • Secondary degeneration due to disrupted cellular functions

    • Differential vulnerability between cell types (e.g., OHCs vs. IHCs) that may reflect intrinsic differences in stress response capabilities rather than Tmcc2 expression patterns

  • Developmental vs. homeostatic effects: The congenital nature of hearing loss in Tmcc2 knockout mice suggests roles in development or early postnatal maturation . Researchers should determine whether observed cellular changes represent:

    • Developmental defects (failure to establish normal function)

    • Homeostatic failures (inability to maintain function)

    • Accelerated degeneration (premature activation of cell death pathways)

What are the challenges in studying Tmcc2 protein isoforms?

Analysis of Tmcc2 protein isoforms presents several challenges:

  • Isoform diversity: Human brain-derived Tmcc2 exists as at least three distinct isoforms detectable by western blotting . The relative abundance of these isoforms varies between:

    • Different brain regions (temporal gyrus vs. cerebellum)

    • APOE genotype status

    • Presence or absence of dementia

  • Antibody limitations: Commercial antibodies against Tmcc2 may:

    • Detect several non-specific weak bands

    • Have low affinity, making detection challenging in tissues with low expression

    • Work effectively for western blotting but poorly for immunostaining applications

  • Regional variations: Expression patterns and isoform ratios differ between brain regions, requiring comprehensive sampling when studying brain-related functions of Tmcc2 .

  • Species differences: While the interaction between Tmcc2 and APP is evolutionarily conserved from Drosophila to mammals, there may be species-specific variations in isoform expression and function that should be considered when translating findings between model systems and humans .

To address these challenges, researchers should:

  • Validate antibodies using knockout tissues as negative controls

  • Employ multiple detection methods (western blotting, immunoprecipitation, mass spectrometry)

  • Consider region-specific and cell-type-specific analyses rather than whole tissue homogenates

  • Compare isoform patterns across different experimental conditions to identify functionally relevant shifts

What are promising areas for future Tmcc2 research?

Several promising research directions emerge from current knowledge about Tmcc2:

  • Mechanistic studies of ER stress regulation: Further investigation into how Tmcc2 maintains ER homeostasis could reveal:

    • Direct protein-protein interactions with ER stress sensors or UPR components

    • Roles in protein/lipid trafficking or calcium homeostasis

    • Potential therapeutic targets for ER stress-related disorders

  • Genetic interactions in erythropoiesis: The observation that Tmcc2 knockout phenotypes vary by genetic background suggests modifier genes influence Tmcc2 function in erythropoiesis . Identifying these genetic modifiers could:

    • Reveal new regulatory pathways in erythroid development

    • Provide insights into potential compensatory mechanisms

    • Identify targets for intervention in erythropoietic disorders

  • Therapeutic implications for Alzheimer's disease: The association of Tmcc2 with APP, apoE, and AD pathology suggests potential therapeutic relevance :

    • Modulating Tmcc2-APP-apoE interactions could influence amyloid pathology

    • Tmcc2 could serve as a biomarker for certain aspects of AD progression

    • The distinctive pathological features in Down syndrome AD may reveal unique mechanisms involving Tmcc2

  • Inner ear development and degeneration: Further characterization of Tmcc2's role in auditory function could:

    • Identify pathways protecting hair cells from ER stress-induced death

    • Develop interventions to prevent hearing loss in conditions with elevated ER stress

    • Establish models for studying progressive sensorineural hearing loss

  • Structural biology of Tmcc protein family: Detailed structural studies could:

    • Characterize the transmembrane and coiled-coil domains that define this protein family

    • Identify structural determinants of interaction with APP and apoE

    • Reveal how structural features relate to specific functions in different tissues

These research directions, pursued through integrated multi-omics approaches , could significantly advance our understanding of Tmcc2 biology and its relevance to human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.