Recombinant Mouse Transmembrane and ubiquitin-like domain-containing protein 1 (Tmub1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
Tmub1; Hops; Transmembrane and ubiquitin-like domain-containing protein 1; Hepatocyte odd protein shuttling protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmub1
Target Protein Sequence
MALIEGVGDEVTVLFAVLACLLVLALAWVSTHTTESTDPQPQPPGTTTPAQPSEAMSASD SIREEAPGAESPSLRHRGPSAQPEPDTGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWP QDTIGSLKRTQFPGQEQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPP CPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAF AMYRP
Uniprot No.

Target Background

Function

Recombinant Mouse Transmembrane and ubiquitin-like domain-containing protein 1 (Tmub1) is involved in several key cellular processes. These include sterol-regulated ubiquitination and degradation of HMG-CoA reductase (HMGCR), positive regulation of AMPA-selective glutamate receptor GRIA2 recycling to the cell surface, and negative regulation of hepatocyte growth during regeneration. Additionally, Tmub1 may contribute to translational regulation during cell cycle progression, cell proliferation regulation, centrosome assembly, and modulation of tumor suppressor CDKN2A stability and nucleolar localization, enhancing its association with NPM1.

Gene References Into Functions
  1. HOPS exhibits distinct, isoform-specific functions within the nucleolus, nucleus, and cytoplasm. PMID: 24240191
  2. HOPS acts as a functional bridge in the interaction between NPM and p19(Arf). PMID: 22890319
  3. Tmub1 is implicated in the regulation of locomotor activity and wakefulness, and it appears to bind to and function with CAMLG. PMID: 20582322
  4. HOPS plays a role in centrosome assembly and maintenance. PMID: 18418082
  5. Tmub1 contributes to maintaining the synaptic surface number of GluR2-containing AMPARs by facilitating GluR2 recycling to the plasma membrane. PMID: 18665261
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane. Recycling endosome. Cytoplasm. Nucleus. Nucleus, nucleolus.; [Isoform 1]: Membrane.; [Isoform 2]: Membrane.; [iHOPS]: Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus, nucleolus. Nucleus.
Tissue Specificity
Expressed in adult brain; at protein level. Isoform 1 (lHOPS) is highly expressed in small intestine, stomach and epididymis. Isoform 2 (sHOPS) and iHOPS are abundantly expressed in brain, liver and adrenal gland.

Q&A

What is the structural composition of Tmub1 and how does it relate to its function?

Tmub1 is characterized by three key structural elements that contribute to its diverse functions. It contains three transmembrane domains that anchor it to cellular membranes, a ubiquitin-like (UBL) domain that enables protein-protein interactions and potential post-translational modifications, and a nuclear export signal (NLS) that facilitates shuttling between cellular compartments . The UBL domain is particularly significant as it allows Tmub1 to participate in ubiquitylation-like processes, potentially modifying other proteins in a manner similar to, but distinct from, canonical ubiquitylation .

The structural composition directly relates to Tmub1's functional versatility. The transmembrane domains enable its association with the nuclear envelope and endoplasmic reticulum, while the UBL domain facilitates interactions with cyclins and other cell cycle regulators. Experimental approaches to study these structural domains typically involve creating domain-specific deletion mutants and assessing resulting phenotypic changes. Researchers should consider employing circular dichroism spectroscopy, X-ray crystallography, or NMR spectroscopy to further elucidate the three-dimensional structure of these domains and their interactions with binding partners.

How does Tmub1 shuttling between cellular compartments influence its biological activity?

Tmub1 demonstrates dynamic subcellular localization that correlates with its biological functions. It actively shuttles between the nucleus and cytoplasm during cell cycle progression, with its localization pattern serving as a regulatory mechanism . Research shows that Tmub1 is predominantly nuclear during growth arrest but is actively exported from the nucleus in dividing cells . This shuttling behavior is critical to its role in cell cycle regulation and liver regeneration.

To investigate this phenomenon, researchers should implement live-cell imaging with fluorescently tagged Tmub1 constructs combined with cell synchronization techniques. Treatment with leptomycin B, an inhibitor of CRM-1-dependent nuclear export, can help elucidate the mechanism of Tmub1 shuttling since Tmub1 contains a classical Nuclear Export Signal (NES) domain that interacts with the exportin chromosome region maintenance 1 protein (CRM-1) . Time-lapse microscopy during different cell cycle phases would provide valuable insights into the temporal dynamics of Tmub1 localization. Additionally, fractionation studies comparing nuclear versus cytoplasmic Tmub1 levels during various cellular states can quantitatively assess this shuttling behavior.

What expression patterns of Tmub1 are observed across different tissues and developmental stages?

While the search results don't provide comprehensive tissue expression profiles, they indicate that Tmub1 is ubiquitously expressed across multiple tissues . Initial identification of the gene occurred in a cDNA library of rat regenerating liver , suggesting its importance in hepatic tissue. Expression has been confirmed in liver cells, brain tissue, and immune cells including bone marrow-derived macrophages (BMDMs) and splenocytes .

To thoroughly characterize tissue-specific expression patterns, researchers should employ quantitative RT-PCR across multiple tissues and developmental timepoints in mouse models. RNA-seq analysis would provide more comprehensive insights into expression levels and potential splice variants across tissues. Immunohistochemistry using validated antibodies against Tmub1 would complement these approaches by visualizing protein distribution within tissue architectures. Western blotting of tissue lysates can quantify relative protein abundance across different organs. Researchers investigating developmental regulation should examine embryonic tissues at various stages to establish temporal expression patterns.

How does Tmub1 regulate cell cycle progression in hepatocytes?

Tmub1 functions as a negative regulator of cell cycle progression in hepatocytes, particularly affecting the G1/S phase transition . Experimental evidence from BRL-3A rat hepatocyte cells shows that Tmub1 overexpression increases the proportion of cells in G1 phase while decreasing the proportion in S phase. Conversely, Tmub1 knockdown increases S phase cells while decreasing G1 phase cells . This indicates that Tmub1 likely acts as a checkpoint regulator preventing premature entry into S phase.

The regulatory mechanism appears to involve direct interaction with cell cycle proteins, particularly cyclin A2, with which Tmub1 interacts throughout the cell cycle (G1, S, and M phases) . Tmub1 may inhibit the degradation of cyclin A2 and cyclin B1, particularly during M phase, suggesting a role in stabilizing these cyclins at specific points in the cell cycle .

Cell Cycle ManipulationG1 PhaseS PhaseG2/M PhaseCell Proliferation Rate
Tmub1 OverexpressionIncreasedDecreasedNo significant changeDecreased
Tmub1 KnockdownDecreasedIncreasedNo significant changeIncreased
Normal ControlBaselineBaselineBaselineBaseline

Researchers investigating this phenomenon should use flow cytometry with propidium iodide staining to quantify cell cycle distribution, combined with EdU incorporation assays to measure DNA synthesis rates. Cell synchronization techniques using nocodazole (for M phase) or double thymidine block (for G1/S boundary) allow for precise examination of Tmub1's effects at specific cell cycle stages .

What methodologies effectively demonstrate the interaction between Tmub1 and cyclins?

The interaction between Tmub1 and cyclins, particularly cyclin A2, has been demonstrated through co-immunoprecipitation (co-IP) assays . These experiments revealed that Tmub1 binds specifically to cyclin A2 throughout different cell cycle phases (G1, S, and M), but notable interactions with cyclins B1, D1, or E1 were not detected .

To effectively investigate these interactions, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation remains the gold standard and should be performed bidirectionally (pulling down with anti-Tmub1 and probing for cyclins, and vice versa).

  • Proximity ligation assays (PLA) offer in situ visualization of protein interactions with higher sensitivity than traditional co-IP.

  • Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can demonstrate interactions in living cells.

  • For mechanistic studies, in vitro binding assays using purified recombinant proteins can identify direct interactions and binding domains.

  • Cell synchronization is critical - researchers should synchronize cells at specific cell cycle phases (using nocodazole for M phase as demonstrated in the literature) to examine phase-specific interactions .

  • Domain mapping through deletion mutants can identify which regions of Tmub1 are necessary for cyclin binding.

These approaches collectively provide robust evidence for physical interactions between Tmub1 and cyclins while elucidating the functional significance of these interactions in cell cycle regulation.

How can contradictory findings about Tmub1's effects on cyclin A2 be reconciled experimentally?

The research presents an apparent contradiction regarding Tmub1's relationship with cyclin A2. While Tmub1 functions as a negative regulator of cell proliferation and cell cycle progression, knockdown of Tmub1 leads to decreased cyclin A2 expression . This suggests Tmub1 positively regulates cyclin A2 levels despite inhibiting cell proliferation, creating an apparent paradox.

To reconcile these findings experimentally, researchers should:

  • Perform time-course experiments measuring cyclin A2 levels throughout the cell cycle under conditions of Tmub1 overexpression and knockdown.

  • Investigate cyclin A2 stability using cycloheximide chase assays to determine if Tmub1 affects protein degradation rates rather than expression.

  • Examine post-translational modifications of cyclin A2 in the presence and absence of Tmub1, particularly ubiquitylation patterns.

  • Use proteasome inhibitors (e.g., MG132) to determine if Tmub1's effects on cyclin A2 are proteasome-dependent.

  • Assess cyclin A2 activity (not just levels) through CDK2 kinase assays, as Tmub1 might affect cyclin A2 function without altering its expression.

  • Conduct rescue experiments by expressing exogenous cyclin A2 in Tmub1-overexpressing cells to determine if this restores normal cell cycle progression.

These approaches would help determine whether Tmub1 affects cyclin A2 levels, stability, activity, or localization, potentially resolving the apparent contradiction between Tmub1's negative effect on cell proliferation and its positive regulation of cyclin A2 .

What mechanisms underlie Tmub1's role in NF-κB-mediated inflammatory responses?

Tmub1 enhances NF-κB activation, leading to increased transcription of inflammatory mediators through a mechanism involving reduced IκBα stability . The process is mediated by direct binding between Tmub1 and the E3 ubiquitin ligase TRAF6. This interaction reduces TRAF6 stability, ultimately leading to increased IKK complex activation and downstream inflammatory signaling .

Experiments using Tmub1-deficient mice revealed significant reductions in pro-inflammatory gene expression (Il-6, Il-1β, Tnfα) in bone marrow-derived macrophages (BMDMs) at 4 hours post-LPS stimulation compared to wild-type controls . Similar reductions were observed in splenocytes and mouse embryonic fibroblasts (MEFs), although to a lesser extent than in BMDMs .

To investigate this pathway, researchers should:

  • Perform co-immunoprecipitation assays between Tmub1 and components of the NF-κB pathway (IKK complex, IκBα, TRAF6).

  • Use pulse-chase experiments to measure IκBα and TRAF6 stability in the presence and absence of Tmub1.

  • Conduct chromatin immunoprecipitation (ChIP) assays to assess NF-κB binding to target gene promoters under different Tmub1 expression conditions.

  • Implement luciferase reporter assays with NF-κB response elements to quantify pathway activation.

  • Apply time-course analysis of inflammatory gene expression after immune stimulation in Tmub1-manipulated cells.

These methodologies would provide mechanistic insights into how Tmub1 modulates inflammatory responses through the NF-κB signaling pathway.

How can researchers effectively investigate the differential effects of Tmub1 on inflammatory responses across cell types?

The research indicates that Tmub1 deletion affects inflammatory responses differently across cell types, with the strongest effects observed in BMDMs and lesser effects in splenocytes and MEFs . This suggests cell type-specific mechanisms that require targeted investigation approaches.

To effectively study these differential effects, researchers should:

  • Establish primary cell cultures from multiple tissues of Tmub1 knockout and wild-type mice, ensuring consistent isolation protocols.

  • Conduct parallel stimulation experiments using standardized inflammatory triggers (LPS, TNFα, IL-1β) across all cell types.

  • Implement comprehensive transcriptomic analysis (RNA-seq) of the inflammatory response at multiple time points (2h, 4h, 8h, 24h) to capture temporal dynamics.

  • Profile the expression of NF-κB pathway components across cell types to identify differences in the signaling machinery.

  • Perform phospho-proteomics to examine activation states of key inflammatory signaling nodes.

  • Use cell-specific conditional knockout models to determine if the observed differences reflect developmental adaptations or acute signaling mechanisms.

  • Conduct rescue experiments by re-expressing Tmub1 in knockout cells from different tissues to assess reversibility of phenotypes.

This multifaceted approach would help elucidate why Tmub1 exerts stronger effects in some cell lineages than others, potentially revealing tissue-specific co-factors or regulatory mechanisms.

What expression systems are optimal for producing functional recombinant mouse Tmub1?

While the search results don't specifically address recombinant Tmub1 production, effective expression systems can be inferred from Tmub1's structural characteristics. As a transmembrane protein with a ubiquitin-like domain, Tmub1 presents specific challenges for recombinant expression that require careful consideration.

For producing functional recombinant mouse Tmub1, researchers should consider:

  • Mammalian expression systems (HEK293 or CHO cells) are likely optimal for maintaining proper post-translational modifications and membrane integration. These systems should utilize vectors with strong promoters (CMV) and appropriate selection markers.

  • Baculovirus-insect cell systems represent an alternative for higher yield while maintaining most post-translational modifications. Sf9 or High Five™ cells are suitable hosts for this approach.

  • Cell-free expression systems supplemented with microsomes or nanodiscs may be effective for producing membrane-integrated Tmub1.

  • For structural studies, consider fusion tags that enhance solubility (SUMO, MBP) while implementing strategies to maintain the native conformation of transmembrane domains.

  • Codon optimization for the expression host is advisable to improve translation efficiency.

  • For functional studies, fluorescent protein fusions (preferably at the C-terminus to avoid interfering with transmembrane domains) can facilitate trafficking and localization studies.

  • Verify protein functionality through cyclin A2 binding assays, as this interaction is well-established in the literature .

These considerations should guide the development of expression strategies that yield functional recombinant Tmub1 suitable for biochemical, structural, and cellular studies.

What are the most effective approaches for generating and validating Tmub1 knockout models?

The search results mention Tmub1 knockout mice that were "grossly normal" , indicating successful generation of viable Tmub1-deficient models. To effectively generate and validate Tmub1 knockout models, researchers should consider:

  • For mouse models:

    • CRISPR/Cas9-mediated deletion of critical exons (particularly those encoding the UBL domain) is the most efficient approach.

    • Alternatively, homologous recombination in embryonic stem cells can be employed, as referenced in the literature .

    • Validate genomic deletion through PCR genotyping and confirm complete protein loss through Western blotting across multiple tissues.

    • Check for compensatory upregulation of related proteins.

  • For cellular models:

    • CRISPR/Cas9 approaches with multiple guide RNAs targeting critical functional domains.

    • Lentiviral delivery of shRNA for stable knockdown as an alternative to complete knockout.

    • Single cell cloning is essential to obtain homogeneous knockout populations.

    • Validation should include sequencing of the targeted locus, Western blotting, and functional assays (cell cycle analysis, proliferation assays).

  • For phenotypic validation:

    • Cell cycle analysis by flow cytometry should demonstrate increased S phase population and decreased G1 phase, consistent with Tmub1's role as a negative regulator .

    • Proliferation assays (EdU incorporation, CCK-8) should reveal enhanced proliferation rates .

    • For in vivo models, examine liver regeneration responses after partial hepatectomy.

    • Assess inflammatory responses to LPS by measuring cytokine production (IL-6, IL-1β, TNFα) .

These approaches ensure creation of valid models that can reliably demonstrate Tmub1's biological functions in relevant experimental contexts.

What methodology should be employed to study Tmub1's ubiquitin-like domain functions?

Tmub1's ubiquitin-like (UBL) domain is critical to its function, potentially mediating protein-protein interactions and affecting post-translational modifications of cell cycle regulators . Research suggests Tmub1 may inhibit the degradation of cyclin A2 and B1, indicating a role in regulating protein stability .

To effectively study the UBL domain functions, researchers should:

  • Generate domain-specific mutants:

    • Create UBL domain deletion mutants

    • Introduce point mutations at conserved residues critical for UBL function

    • Develop chimeric proteins with UBL domains from other proteins

  • Assess ubiquitylation status of interacting partners:

    • Perform ubiquitylation assays under conditions of Tmub1 overexpression, knockdown, and UBL domain mutation

    • Use lysine-specific ubiquitin mutants to determine ubiquitin chain topology (K48 vs. K63)

    • Employ mass spectrometry to identify ubiquitylation sites on target proteins

  • Identify UBL domain binding partners:

    • Conduct pull-down assays using the isolated UBL domain as bait

    • Perform yeast two-hybrid screening focused on E3 ligases and proteasome components

    • Apply BioID or APEX2 proximity labeling with the UBL domain as bait

  • Assess functional consequences:

    • Measure protein stability/half-life of identified targets using cycloheximide chase assays

    • Evaluate proteasome dependency using specific inhibitors (MG132)

    • Conduct in vitro ubiquitylation assays with purified components

  • Study competitive effects:

    • Determine if Tmub1's UBL domain competes with ubiquitin for binding to certain proteins

    • Assess if it interferes with the recognition of ubiquitylated proteins by the proteasome

These approaches would provide mechanistic insights into how Tmub1's UBL domain influences protein stability and potentially regulates cell cycle progression through post-translational modifications .

How can researchers reconcile Tmub1's seemingly contradictory roles in different cellular processes?

Tmub1 exhibits seemingly contradictory functions across different biological contexts. It inhibits hepatocyte proliferation and cell cycle progression while enhancing inflammatory responses through NF-κB activation . It also regulates locomotor activity and wakefulness in mice while playing a role in liver regeneration . These diverse functions raise questions about how a single protein coordinates multiple cellular processes.

To experimentally reconcile these diverse roles, researchers should:

  • Conduct tissue-specific conditional knockout studies to determine if Tmub1's functions are context-dependent.

  • Perform comprehensive interactome analyses in different tissues/conditions using techniques like BioID, IP-MS, or APEX2 proximity labeling to identify tissue-specific binding partners.

  • Investigate post-translational modifications of Tmub1 itself across tissues and conditions, as these could modulate its function or binding preferences.

  • Use domain-specific mutations to determine which structural features are required for each biological function. For example, does the UBL domain mediate all functions or only a subset?

  • Examine Tmub1 subcellular localization across different cell types and conditions, as its shuttling behavior may vary by context.

  • Develop mathematical models integrating cell cycle regulation and inflammatory signaling to identify potential nodes where Tmub1 might coordinate these processes.

  • Investigate potential isoforms or alternative splice variants that might have specialized functions.

These approaches would help determine whether Tmub1's diverse roles reflect true multifunctionality, context-dependent specialization, or integration of seemingly disparate cellular processes into a coherent biological function .

What experimental designs would effectively elucidate Tmub1's role in liver regeneration?

Tmub1 was initially identified in a cDNA library from regenerating rat liver , suggesting a significant role in liver regeneration, yet its precise functions in this process remain incompletely characterized. To effectively investigate Tmub1's role in liver regeneration, researchers should implement the following experimental approaches:

  • Partial hepatectomy (PH) models:

    • Compare regeneration kinetics between Tmub1 knockout and wild-type mice following 70% PH

    • Analyze BrdU incorporation, mitotic index, and liver-to-body weight ratios at multiple timepoints (24h, 48h, 72h, 7d)

    • Examine hepatocyte proliferation markers (Ki67, PCNA) through immunohistochemistry

  • Temporal expression profiling:

    • Monitor Tmub1 expression patterns (mRNA and protein) throughout regeneration timeline

    • Perform subcellular fractionation to track Tmub1 nuclear-cytoplasmic shuttling during regeneration

    • Use ChIP-seq to identify potential transcriptional targets of Tmub1 during regeneration

  • Mechanistic studies:

    • Analyze cell cycle regulator expression/activity (particularly cyclin A2) in regenerating Tmub1-deficient livers

    • Investigate NF-κB pathway activation, as inflammation is crucial for liver regeneration

    • Examine interaction between Tmub1 and elongation factor eEF-1A, which was reported to bind Tmub1 during liver regeneration

  • Rescue experiments:

    • Adenoviral or AAV-mediated re-expression of Tmub1 in knockout livers prior to PH

    • Expression of domain-specific mutants to identify critical regions for regenerative function

  • Systems biology approach:

    • RNA-seq analysis of regenerating livers from wild-type and Tmub1-deficient mice

    • Pathway analysis to identify Tmub1-dependent regenerative programs

    • Proteomics to identify changes in protein abundance and post-translational modifications

These coordinated approaches would comprehensively characterize Tmub1's contribution to liver regeneration while identifying the molecular mechanisms underlying its functions in this complex physiological process.

How does Tmub1 integrate cell cycle regulation with inflammatory signaling pathways?

The search results reveal that Tmub1 functions in both cell cycle regulation (interacting with cyclins and inhibiting proliferation) and inflammatory signaling (enhancing NF-κB activation) . This dual functionality suggests potential integration between these pathways, which represents an important area for investigation.

To elucidate how Tmub1 might coordinate these processes, researchers should:

  • Conduct temporal analysis of Tmub1's interactions during inflammation:

    • Perform time-course co-immunoprecipitation studies examining Tmub1 binding to cell cycle proteins (cyclin A2) and inflammatory mediators (TRAF6) after inflammatory stimulation

    • Determine if these interactions are mutually exclusive or can occur simultaneously

  • Investigate cross-regulation mechanisms:

    • Assess how cell cycle phase affects inflammatory responses in Tmub1-sufficient versus Tmub1-deficient cells

    • Examine how inflammatory stimulation affects Tmub1's cell cycle regulatory functions

    • Determine if post-translational modifications of Tmub1 differ between proliferative and inflammatory contexts

  • Perform domain mapping studies:

    • Identify which domains are required for cell cycle versus inflammatory functions

    • Create domain-specific mutants that selectively disrupt one function while preserving the other

  • Analyze gene expression programs:

    • Conduct RNA-seq comparing synchronized cells with and without inflammatory stimulation in the presence/absence of Tmub1

    • Identify gene sets that respond to both cell cycle position and inflammatory signals in a Tmub1-dependent manner

  • Develop mathematical models:

    • Create computational models incorporating both cell cycle and inflammatory signaling networks

    • Use these models to predict how perturbations in one pathway affect the other

These approaches would help determine whether Tmub1 functions as a molecular link that coordinates cell cycle progression with inflammatory responses, potentially explaining why a single protein would regulate both processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.