Recombinant Mouse Transmembrane protein 11, mitochondrial (Tmem11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem11; Transmembrane protein 11, mitochondrial; Protein PM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem11
Target Protein Sequence
MAAWGRRRLGPGGGGSRERVSLSATDCYIVHEIYSGENAQDQFEYELEQALEAQYKYIVI EPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLY GISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYC VKKVYELYAV
Uniprot No.

Target Background

Function
Plays a role in mitochondrial morphogenesis.
Database Links
Protein Families
TMEM11 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is TMEM11 and what is its cellular localization?

TMEM11 (Transmembrane protein 11) was initially reported as an inner mitochondrial membrane protein, but recent research has definitively established it as an outer mitochondrial membrane (OMM) protein. Using proximity-based APEX labeling and protease protection assays, Gok et al. demonstrated that TMEM11 is exposed to the cytosol. When APEX2-GFP-TMEM11 expressing cells were treated with DAB and H₂O₂, the DAB precipitate appeared on the exterior of mitochondria. Additionally, proteinase K treatment of intact mitochondria resulted in digestion of both TMEM11 and TOMM20 (a known OMM protein), while the IMM protein MIC60 was protected until the OMM was ruptured .

How does TMEM11 affect mitochondrial morphology?

Depletion of TMEM11 using CRISPR interference or genetic knockout consistently leads to dramatic changes in mitochondrial morphology. In both human cell lines and mouse models, mitochondria become enlarged and/or bulbous compared to the normal narrow tubular mitochondria observed in control cells. Electron microscopy reveals that in TMEM11-depleted cells, cristae membranes become curved and/or highly elongated, frequently spanning the width of the enlarged mitochondria .

This phenotype is consistent across species, as described by Gok et al.: "Consistent with previous work (Rival et al., 2011), more than half of the cells in each TMEM11-depleted cell line exhibited mitochondria that were enlarged and/or bulbous as compared to the narrow tubular mitochondria observed in control cells" .

What techniques are commonly employed to study recombinant TMEM11 function?

Several methodologies are effectively used to study TMEM11:

TechniqueApplicationExample Protocol
Gene silencingFunctional analysisCRISPRi with dCas9-KRAB and sgRNAs targeting TMEM11 transcription start site
Fluorescence microscopyMorphological analysisMitotracker staining followed by confocal microscopy
Electron microscopyUltrastructural analysisDAB/H₂O₂ treatment with APEX2-GFP-TMEM11 for protein localization
2D BN-PAGEProtein complex analysisAnalysis of TMEM11 assembly sizes in isolated mitochondria
Co-immunoprecipitationProtein interaction studiesGFP-TMEM11 pulldown with anti-GFP antibody followed by immunoblotting
Mitophagy assaysFunctional assessmentmito-mKeima reporter for measuring acidified mitochondria

How is TMEM11 expression affected in different physiological conditions?

Unlike BNIP3 and BNIP3L, which are transcriptionally upregulated during hypoxia, TMEM11 protein levels remain stable under hypoxia-mimetic conditions such as CoCl₂ treatment. This differential regulation is significant for understanding mitophagy regulation, as TMEM11 appears to function as a constitutive regulator rather than an inducible factor .

While respiratory function measured by oxygen consumption rate (OCR) is minimally affected in TMEM11-depleted cells despite substantial morphological changes , TMEM11 deficiency leads to increased sensitivity to mitophagy induction. This suggests TMEM11 plays a role in maintaining mitochondrial quality control under basal conditions .

What is the molecular mechanism by which TMEM11 regulates mitophagy through BNIP3/BNIP3L?

TMEM11 forms a complex with the mitophagy receptors BNIP3 and BNIP3L on the outer mitochondrial membrane. These interactions were confirmed by multiple approaches:

  • 2D BN-PAGE analysis shows TMEM11, BNIP3, and BNIP3L enriched in ~400 kD complexes

  • Co-immunoprecipitation experiments demonstrate robust interactions between TMEM11 and both BNIP3L and BNIP3

  • Size-shift experiments with APEX2-GFP-TMEM11 showed corresponding increases in BNIP3/BNIP3L complex size

TMEM11 functions as a negative regulator of BNIP3/BNIP3L-dependent mitophagy. In TMEM11-depleted cells, there is increased basal mitophagy that can be rescued by silencing BNIP3 and BNIP3L . Mechanistically, TMEM11 co-enriches with BNIP3 at sites of mitophagosome formation, and in its absence, these sites dramatically increase along the mitochondrial membrane .

This supports a model where TMEM11 demarcates specific regions of the mitochondrial network for selective degradation, potentially linking mitochondrial interior dysfunction to the external mitophagy machinery.

How does TMEM11 interact with the MICOS complex and what is the functional significance?

A subset of TMEM11 assembles into larger molecular weight complexes that depend on the MICOS (Mitochondrial Contact Site and Cristae Organizing System) complex. When MIC60, a core MICOS subunit, is depleted, these larger TMEM11 assemblies are impaired, though TMEM11 protein levels remain stable .

The interaction between TMEM11 and MICOS appears to be indirect, likely through interactions with MIB (Mitochondrial Bridging) components like SAMM50 on the outer mitochondrial membrane. Importantly, TMEM11 depletion does not affect MICOS complex assembly or stability .

The functional significance may involve cooperative regulation of mitophagy:

"Depletion of MIC60, which destabilizes the MICOS complex, leads to a similar increase in BNIP3/BNIP3L-dependent mitophagy as depletion of TMEM11, suggesting their interaction may cooperatively regulate mitophagy" .

This suggests TMEM11 may interact with MICOS/MIB to sense mitochondrial dysfunction from the interior and restrict mitophagy to specific sites.

What explains the contradictions in the literature regarding TMEM11 localization?

The localization of TMEM11 has been a point of confusion in the literature. Early studies placed TMEM11 in the inner mitochondrial membrane (IMM), which was difficult to reconcile with its reported interactions with outer mitochondrial membrane (OMM) proteins like BNIP3/BNIP3L.

This contradiction has been resolved by recent work demonstrating conclusively that TMEM11 is an OMM protein. The confusion likely stemmed from:

  • Technical limitations in earlier subcellular fractionation approaches

  • The small proportion of TMEM11 that associates with MICOS/MIB complex

  • The small size and complex membrane topology of TMEM11

As noted by McWilliams: "Like non-selective macroautophagy, studies of mitophagy reporter mice, flies, and fish have also revealed that mitochondrial turnover readily occurs within our tissues at resting steady state (basal mitophagy). While our knowledge of damage-induced mitophagy is extensive, our understanding of the signals that control basal mitophagy is comparably limited" .

The corrected localization to the OMM has been crucial for understanding TMEM11's functional role in mitophagy regulation.

What is the role of TMEM11 in specific cell types like macrophages?

In macrophages, TMEM11 affects mitochondrial morphology but has limited impact on function. A study by Do (2023) demonstrated that TMEM11-deficient bone marrow-derived macrophages (BMDMs) displayed abnormal mitochondrial morphology similar to other cell types, but maintained expression of key mitochondrial architecture proteins including MIC60 and MIC10 .

Surprisingly, TMEM11 deletion did not affect macrophage polarization:

"The fact that polarization was unaffected by the loss of TMEM11 potentially demonstrates that even though the morphology of the mitochondria is significantly altered, respiratory capabilities may be unaffected" .

This contrasts with typical mitochondrial dysfunction, which pushes macrophages toward proinflammatory (M1) polarization. The finding suggests contextual differences in TMEM11 function across cell types, with macrophages potentially having compensatory mechanisms that preserve function despite morphological changes.

How can recombinant TMEM11 be used to analyze protein-protein interactions relevant to mitophagy?

Recombinant TMEM11 has proven valuable for studying protein-protein interactions that regulate mitophagy. Several approaches have been employed:

  • Yeast two-hybrid systems: Researchers have recapitulated published interactome data by expressing TMEM11 constructs in yeast two-hybrid systems to confirm direct interactions with BNIP3 and BNIP3L .

  • GFP-TMEM11 fusion proteins: GFP-tagged TMEM11 has been used for immunoprecipitation experiments to validate and characterize interactions with partner proteins .

  • APEX2-tagged constructs: APEX2-GFP-TMEM11 has been employed for both proximity labeling and size-shift assays. In the latter application, the increased size of the fusion protein causes detectable shifts in the molecular weight of interacting partners in 2D BN-PAGE analysis .

When designing recombinant TMEM11 constructs, it's critical to preserve the transmembrane domain integrity and proper membrane topology, as these features are essential for authentic interactions with partners like BNIP3/BNIP3L.

What spatial regulatory mechanisms does TMEM11 employ in mitophagy regulation?

TMEM11 appears to play a key role in the spatial regulation of mitophagy initiation. When TMEM11 is depleted, there is a significant increase in BNIP3-enriched structures on the mitochondrial membrane, suggesting it normally restricts the formation of mitophagosome initiation sites .

This spatial regulation has several implications:

  • TMEM11 may help confine mitophagy to specific damaged regions of the mitochondrial network

  • It could prevent excessive mitochondrial degradation under basal conditions

  • It may coordinate mitophagy with other mitochondrial quality control mechanisms

As McWilliams noted: "Understanding how TMEM11 governs the formation and abundance of mitophagy initiation sites on mitochondria may prove pivotal in cracking the code that controls basal mitophagy, at least in specific tissue types" .

The exact molecular mechanisms by which TMEM11 restricts mitophagosome formation sites remains an active area of investigation. Current evidence suggests TMEM11 might regulate BNIP3/BNIP3L dimerization, phosphorylation, or interactions with the autophagy machinery.

How can IL-11 receptor studies inform research on membrane proteins like TMEM11?

Though functionally distinct, research methodologies used for IL-11 receptor studies provide valuable approaches for TMEM11 research. The IL-11 receptor alpha forms a complex with gp130, analogous to how TMEM11 forms complexes with partner proteins. Recombinant IL-11 receptor constructs have been designed to preserve key structural features while enabling solubility and detection .

For TMEM11 studies, similar design principles should be considered:

Design FeatureIL-11 R alpha ExampleTMEM11 Application
Domain preservationExtracellular domain (aa 26-367) with Fc fusion Preserve transmembrane domains and interaction sites
Tag placementC-terminal tags avoid disrupting ligand binding Position tags to minimize disruption of BNIP3/BNIP3L binding
Expression systemsHEK293 cells for proper folding Mammalian expression systems to ensure proper membrane insertion

What are the optimal experimental systems for studying recombinant TMEM11 function?

Based on the literature, several experimental systems have proven effective for TMEM11 studies:

  • U2OS and HeLa cell lines: These have been successfully used for TMEM11 depletion and reconstitution studies, with robust mitophagy phenotypes observed .

  • CRISPRi systems: The use of dCas9-KRAB with sgRNAs targeting the TMEM11 transcription start site provides efficient knockdown without complete elimination, which can be advantageous for studying dose-dependent effects .

  • Mitophagy reporter systems: mito-mKeima has been effective for measuring mitophagy in TMEM11 studies, allowing quantification of acidified mitochondria under various conditions .

  • Genetic knockout mice: TMEM11-deficient mice have been used to study tissue-specific effects, particularly in macrophages .

When reconstituting TMEM11 expression, it's important to use physiological expression levels, as overexpression can lead to artifacts in mitochondrial morphology and interaction patterns.

What experimental controls are essential when studying recombinant TMEM11?

Proper controls are critical when studying a complex mitochondrial protein like TMEM11:

  • Localization controls: Include both outer membrane (e.g., TOMM20) and inner membrane (e.g., MIC60) markers to confirm proper localization .

  • Interaction specificity controls: Include abundant OMM proteins like TOMM20 that should not interact with TMEM11 to demonstrate specificity of observed interactions .

  • Functional redundancy controls: Consider knockdown of related proteins to control for potential compensatory mechanisms.

  • Expression level controls: Monitor expression levels of BNIP3 and BNIP3L, which can vary significantly with cellular conditions and affect mitophagy independent of TMEM11 .

  • Mitophagy pathway controls: Include controls for general autophagy (e.g., starvation-induced) to distinguish specific effects on mitophagy from general autophagy alterations .

What are the emerging questions regarding TMEM11's role in mitochondrial quality control?

Several important questions remain to be addressed:

  • Mechanism of site specification: How does TMEM11 determine which regions of mitochondria should be marked for mitophagy?

  • Signaling pathways: What upstream signals regulate TMEM11's interaction with BNIP3/BNIP3L?

  • Post-translational modifications: Does TMEM11 undergo modifications that alter its function in response to cellular stresses?

  • Tissue-specific roles: Why do macrophages maintain functionality despite morphological changes in TMEM11 deficiency?

As highlighted by McWilliams: "Several important mechanistic questions remain... Does TMEM11 alter BNIP3/NIX dimerization, which occurs via its transmembrane domains and appears essential for mitophagy? Might TMEM11 inhibition modify the magnitude of mitophagy by influencing BNIP3/BNIP3L interactions with the autophagy machinery?"

How might TMEM11 research contribute to understanding mitochondrial diseases?

TMEM11's role in regulating mitophagy has implications for numerous diseases involving mitochondrial dysfunction:

  • Neurodegenerative disorders: Since proper mitochondrial quality control is crucial for neuronal health, TMEM11 dysregulation might contribute to conditions like Parkinson's disease.

  • Metabolic disorders: TMEM11's ability to preserve mitochondrial function despite morphological changes could inform treatments for metabolic diseases.

  • Inflammatory conditions: The finding that TMEM11-deficient macrophages maintain polarization capabilities suggests complex relationships between mitochondrial morphology and inflammatory responses.

Understanding how TMEM11 spatially restricts mitophagy could lead to therapeutic approaches that modulate mitochondrial turnover in a targeted manner rather than globally affecting mitochondrial function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.