Recombinant Mouse Transmembrane protein 111 (Tmem111)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Transmembrane Protein 111 (TMEM111)

Recombinant Mouse Transmembrane Protein 111 (TMEM111) is a protein belonging to the family of transmembrane proteins, which are integral components of cellular membranes. These proteins play crucial roles in various cellular processes, including signaling, transport, and cell-cell interactions. Despite its importance, detailed structural and functional information about TMEM111 is limited compared to other transmembrane proteins.

Overview of Transmembrane Proteins

Transmembrane proteins are embedded within the lipid bilayer of cell membranes and can span the membrane once or multiple times. They are involved in a wide range of biological functions, such as ion transport, cell signaling, and the recognition of extracellular ligands. The study of recombinant forms of these proteins allows researchers to explore their functions in a controlled manner.

Research Challenges and Future Directions

Given the lack of detailed information on TMEM111, future research should focus on:

  • Structural Analysis: Determining the three-dimensional structure of TMEM111 could provide insights into its function and potential binding sites.

  • Functional Studies: Investigating the protein's role in cell signaling or transport processes could reveal its biological significance.

  • Expression Patterns: Analyzing TMEM111 expression across different tissues and conditions may help identify its physiological relevance.

Data Table: Relevant Information on TMEM111

Probe IDGene SymbolEntrez Gene NameExpression ChangeStatistical SignificanceHeritability
1812325TMEM111Transmembrane protein 111CV↓9.48E−130.75

References

- Identification of brain transcriptional variation reproduced in ... (2009)
- Variably expressed networks: Topics by Science.gov

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Emc3; Tmem111; ER membrane protein complex subunit 3; Transmembrane protein 111
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-261
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Emc3
Target Protein Sequence
AGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVL RENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPM ILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRS IYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEEL MARDLHFEGMFKKELQTSIF
Uniprot No.

Target Background

Function

Transmembrane protein 111 (TMEM111) is a component of the endoplasmic reticulum membrane protein complex (EMC). It facilitates the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. TMEM111 preferentially accommodates proteins with weakly hydrophobic transmembrane domains or those containing destabilizing features such as charged and aromatic residues. It is involved in the co-translational insertion of multi-pass membrane proteins, where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. Additionally, it's essential for the post-translational insertion of tail-anchored (TA) proteins into ER membranes. By mediating the correct co-translational insertion of N-terminal transmembrane domains in an N-exo topology (with a translocated N-terminus in the ER lumen), TMEM111 regulates the topology of multi-pass membrane proteins, such as G protein-coupled receptors. Through its role in regulating protein membrane insertion, it indirectly influences various cellular processes.

Database Links
Protein Families
EMC3 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.