Recombinant Mouse Transmembrane protein 121 (Tmem121)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

Tmem121 regulates proliferation, migration, and signaling pathways across cell types:

Table 2: Functional Findings from Experimental Studies

Cell Type/ModelKey ObservationsMechanism/Pathway Involved
Cervical Cancer (HeLa)- Overexpression reduces cell viability by 40–60% .PI3K/AKT suppression; p-p38 upregulation
- Inhibits migration (50% wound closure rate reduction) .Downregulation of BCL-2, cyclin D1/E2
Adrenocortical Stem Cells- Elevates proliferation markers Ki67 and PCNA .ERK/MAPK signaling

Research Applications

Recombinant Tmem121 is critical for:

  • In vitro functional assays: Overexpression/knockdown studies in cancer models .

  • Protein interaction studies: Investigating binding partners like AKT1, CASP3, and CDH1 .

  • Diagnostic tool development: Detected via ELISA (MBS7217270 kit) with high specificity .

Mechanistic Insights from Pathway Analysis

  • PI3K/AKT pathway: Tmem121 overexpression in HeLa cells reduces phosphorylated AKT levels, correlating with anti-proliferative effects .

  • Cell cycle regulation: Downregulates cyclins (D1, E2) and upregulates p27, inducing G1/S phase arrest .

  • Migration modulation: Suppresses E-cadherin loss, maintaining epithelial integrity .

Comparative Analysis Across Studies

Study FocusSpeciesKey OutcomeCitation
Cervical cancerHumanTMEM121 acts as a tumor suppressor
Adrenocortical cellsRat/MouseProliferation enhancement via Ki67/PCNA
Recombinant productionMouseHigh-purity protein for functional assays

Future Directions

  • Therapeutic targeting: Explore Tmem121’s role in chemoresistance (e.g., KRAS-mutated cancers) .

  • Stem cell dynamics: Investigate regenerative potential in adrenal cortex models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Tmem121; Hole; Transmembrane protein 121; Protein hole
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem121
Target Protein Sequence
MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVA VWVGAEVRTAKRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVC VPGLFLLLVALDRMEYVRTFRKREDLRGRLFWVALDLLDLLDMQANLWEPPRTGLPLWAE GLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQKMMLYPVLSLATVNVVAVLARAANMALF RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALALELQPPPSQRNSVPPPPPLH GPPVRPHGPSPTRDALDT
Uniprot No.

Target Background

Function
Tmem121 may play a role in MAPK signaling.
Gene References Into Functions
  1. Mouse Tmem121 is not expressed in the developing heart, although it shares neural expression observed in the chick. PMID: 12204283
Database Links
Protein Families
TMEM121 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of mouse Tmem121?

Tmem121 (transmembrane protein 121, also known as "hole") is a multi-pass membrane protein that consists of 318 amino acids in mouse . The protein contains multiple transmembrane domains that anchor it within cellular membranes. The full-length coding sequence can be amplified using specific primers and appropriate PCR conditions, with the mouse variant showing high homology to other mammalian Tmem121 proteins. Research typically utilizes His-tagged recombinant versions for functional studies .

What is the tissue distribution pattern of Tmem121?

Histological studies have demonstrated high expression of Tmem121 in the capsule and sub-capsular areas of the adrenal cortex . This localization pattern suggests a potential role in adrenocortical function. Studies utilizing immunocytofluorescence have shown Tmem121 co-expression with Thy-1, a marker for stem/progenitor adrenocortical cells, indicating a possible role in adrenal development or regeneration .

What expression systems are available for recombinant mouse Tmem121?

Multiple expression systems have been developed for recombinant Tmem121 production:

Expression SystemHostTagsProtein LengthApplications
E. coliBacterialHisFull Length (1-318)Biochemical assays, antibody production
Mammalian CellsEukaryoticHisFull LengthFunctional studies, protein-protein interactions

Choosing the appropriate expression system depends on experimental objectives, with mammalian expression systems preferred for functional studies requiring proper folding and post-translational modifications .

What methodologies are recommended for Tmem121 gene cloning and expression?

Successful Tmem121 gene cloning involves a multi-step process as demonstrated in adrenal cortex research:

  • RNA isolation using TRIzol reagent (typical yield: 0.8-1.2μg with high purity)

  • First-strand cDNA synthesis using reverse transcriptase

  • PCR amplification with gene-specific primers:

    • Forward primer: 5'-GCAGGACCTCGTCCCGCTTT-3' (position 194-217)

    • Reverse primer: 5'-TAGTCCAGCGTCTGTGCGGC-3' (position 1252-1233)

  • PCR conditions: 94°C for 1 minute (initial denaturation), followed by 36 cycles of 94°C for 20 seconds, 59°C for 20 seconds, 72°C for 3 minutes

  • Addition of restriction sites (e.g., EcoRI and HindIII) for directional cloning

  • Vector insertion (e.g., pIRES2-ERFP or pcDNA3.1)

  • Transformation into competent cells

  • Verification through sequencing and expression analysis

This protocol yields a functional Tmem121 construct that can be used for transfection and expression studies.

How can researchers effectively analyze Tmem121 expression changes?

For quantitative analysis of Tmem121 expression, the following methodological approach is recommended:

  • Real-time PCR (RT-qPCR):

    • Use the ΔΔCt method for comparative quantification

    • Recommended housekeeping gene: β-Actin

    • Primer design considerations: amplicon size 100-150bp, spanning exon-exon junctions

    • Sample preparation: 400ng RNA for cDNA synthesis

    • qPCR reaction setup: 0.3μL primers mix (5μM each), 7μL SYBR Green master mix, 6.7μL diluted cDNA

  • Protein expression analysis:

    • Western blotting with validated anti-Tmem121 antibodies

    • Immunocytofluorescence using 1:200 dilution of anti-Tmem121 antibody (ab151077)

    • Secondary detection with appropriate Alexa-fluor conjugated antibodies (546 or 647)

Statistical analysis should employ Dunnett's Multiple Comparison Test or one-way ANOVA as appropriate for experimental design.

What is known about Tmem121's role in cellular proliferation and cancer?

Research has identified Tmem121 as a potential tumor suppressor, particularly in cervical cancer models:

  • Expression pattern in cancer:

    • Significantly downregulated in cervical squamous cell carcinoma and endocervical adenocarcinoma compared to normal tissues

    • Increased promoter methylation in tumor tissues, suggesting epigenetic silencing

  • Functional effects of Tmem121 manipulation:

    • Overexpression significantly reduces cancer cell viability

    • Inhibits cell migration (measured by scratch healing assays)

    • Affects multiple signaling pathways related to tumor progression

  • Molecular mechanism:

    • Overexpression downregulates oncogenic factors: BCL-2, cyclin D1, cyclin E2, phosphorylated AKT

    • Upregulates tumor suppressors: p27, E-cadherin, phosphorylated p38

    • Knockdown inhibits: retinoblastoma protein, p53, p27, E-cadherin, phosphorylated JNK, phosphorylated p38

    • Knockdown promotes: cyclin E1

These findings suggest Tmem121 functions as a regulator of cell proliferation and migration through interaction with multiple signaling networks.

What techniques are optimal for studying Tmem121's protein-protein interactions?

To elucidate Tmem121's interaction network, researchers should consider:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-Tmem121 antibodies (e.g., ab151077) for pulldown experiments

    • Verify specificity through reverse Co-IP

    • Analyze precipitated complexes by mass spectrometry

  • Proximity ligation assays:

    • Enables visualization of protein interactions in situ

    • Requires validated antibodies against both Tmem121 and potential interacting partners

  • Yeast two-hybrid screening:

    • Useful for identifying novel interaction partners

    • Requires construction of appropriate bait constructs containing Tmem121 domains

  • Bioinformatic analysis:

    • Database mining for predicted interactions based on structural domains

    • Network analysis to identify signaling pathway connections

Current research indicates Tmem121 may interact with components of the PI3K/AKT and MAPK signaling pathways, warranting further investigation using these techniques .

How does Tmem121 expression relate to adrenal gland function?

Tmem121's high expression in the adrenal cortex, particularly in capsular and sub-capsular regions, suggests potential roles in:

  • Adrenocortical development:

    • Co-expression with Thy-1 (stem/progenitor cell marker) indicates a possible role in progenitor cell function

    • May regulate proliferation of adrenocortical stem/progenitor cells

  • Adrenocortical zonation:

    • Specific localization pattern suggests zone-specific functions

    • Potentially involved in establishing or maintaining functional zones of the adrenal cortex

  • Stress response regulation:

    • Expression patterns may be altered under stress conditions

    • Could modulate cellular responses to hormonal stimulation

Research methodologies should include immunohistochemical analysis across developmental timepoints, laser capture microdissection of specific adrenocortical zones, and functional studies in adrenal cell models with Tmem121 overexpression or knockdown.

What approaches are recommended for Tmem121 knockdown studies?

For effective Tmem121 knockdown:

  • siRNA approach:

    • Design multiple siRNAs targeting different regions of Tmem121 mRNA

    • Transfect using standard lipofection protocols

    • Confirm knockdown efficiency by RT-qPCR and western blot

  • shRNA approach for stable knockdown:

    • Clone shRNA sequences into appropriate vectors (e.g., pLKO.1)

    • Generate lentiviral particles for transduction

    • Select transduced cells using appropriate antibiotic resistance

    • Validate knockdown at both mRNA and protein levels

  • CRISPR-Cas9 gene editing:

    • Design guide RNAs targeting exonic regions of Tmem121

    • Confirm editing efficiency using T7 endonuclease assay or sequencing

    • Isolate and expand clonal populations with confirmed mutations

The choice of method depends on the required duration and completeness of knockdown, with CRISPR providing more permanent modification but potentially greater off-target effects.

How can researchers optimize recombinant Tmem121 purification?

As a multi-pass membrane protein, Tmem121 presents specific purification challenges:

  • Expression system selection:

    • E. coli: Higher yield but potential folding issues

    • Mammalian cells: Better folding but lower yield

    • Insect cells: Good compromise between yield and folding

  • Solubilization strategy:

    • Test multiple detergents (DDM, CHAPS, Triton X-100)

    • Optimize detergent-to-protein ratios

    • Consider nanodiscs or amphipols for maintaining native structure

  • Purification protocol:

    • Immobilized metal affinity chromatography (IMAC) using His-tag

    • Size exclusion chromatography for further purification

    • Avoid harsh elution conditions that may denature the protein

  • Quality control assessments:

    • SDS-PAGE and western blot to confirm purity and identity

    • Circular dichroism to assess secondary structure

    • Functional assays to confirm biological activity

Recombinant Tmem121 has been successfully produced with His-tags in both E. coli and mammalian expression systems .

What considerations are important when designing experiments to study Tmem121 regulation?

When investigating Tmem121 regulatory mechanisms:

  • Transcriptional regulation:

    • Promoter analysis using luciferase reporter assays

    • ChIP-seq to identify transcription factor binding sites

    • DNA methylation analysis using bisulfite sequencing

  • Post-transcriptional regulation:

    • mRNA stability assays using actinomycin D chase

    • miRNA target prediction and validation

    • RNA immunoprecipitation to identify RNA-binding proteins

  • Post-translational regulation:

    • Phosphorylation site mapping using mass spectrometry

    • Ubiquitination analysis to assess protein stability

    • Subcellular localization studies using fractionation and imaging

  • Experimental controls:

    • Include tissue-specific positive and negative controls

    • Account for cell density and passage number effects

    • Consider temporal dynamics of regulation

Research has identified promoter methylation as one regulatory mechanism in cancer contexts, suggesting epigenetic regulation is an important area for further investigation .

What are the key unanswered questions about Tmem121 function?

Critical areas for future Tmem121 research include:

  • Physiological role in normal tissues:

    • Function in adrenal cortex development and homeostasis

    • Potential roles in other tissues where expressed

    • Knockout mouse phenotype characterization

  • Detailed molecular mechanisms:

    • Structure-function relationships of transmembrane domains

    • Comprehensive protein interaction network

    • Signaling pathway integration

  • Disease relevance beyond cervical cancer:

    • Expression and function in other cancer types

    • Potential role in adrenal disorders

    • Biomarker potential in disease diagnosis or prognosis

  • Therapeutic targeting:

    • Development of small molecules modulating Tmem121 function

    • Gene therapy approaches to restore Tmem121 expression

    • Combination strategies with existing therapeutics

What emerging technologies could advance Tmem121 research?

Novel methodologies likely to impact Tmem121 research include:

  • Single-cell technologies:

    • scRNA-seq to map expression across cell populations

    • CITE-seq for simultaneous protein and RNA profiling

    • Spatial transcriptomics to map expression within tissues

  • Advanced imaging approaches:

    • Super-resolution microscopy for precise subcellular localization

    • Live-cell imaging to track Tmem121 dynamics

    • Correlative light and electron microscopy for structural context

  • Systems biology integration:

    • Multi-omics data integration (transcriptomics, proteomics, metabolomics)

    • Network modeling of Tmem121's role in cellular pathways

    • Machine learning approaches to predict functional relationships

  • In vivo gene editing:

    • Tissue-specific CRISPR-Cas9 modification

    • Inducible knockout/knockin models

    • Humanized mouse models for translational research

These approaches will facilitate more comprehensive understanding of Tmem121's biological functions and disease relevance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.