Recombinant Mouse Transmembrane protein 126B (Tmem126b)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant mouse Tmem126b is typically produced in E. coli systems for high-yield expression. Key specifications include:

ParameterDetails
Expression SystemE. coli
TagN-terminal His tag for affinity purification
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionRecommended in sterile water with 50% glycerol for long-term stability

Functional Role in Mitochondrial Complex I Assembly

Tmem126b is a critical component of the MCIA complex, which facilitates the assembly of the membrane arm of mitochondrial complex I (NADH:ubiquinone oxidoreductase) . Key findings include:

  • Knockdown Effects: Loss of Tmem126b disrupts recruitment of assembly factors (e.g., ACAD9, ECSIT) to mitochondrial membranes, leading to:

    • Impaired complex I assembly .

    • Reduced mitochondrial respiration and ATP production .

    • Increased mitochondrial ROS levels .

  • Pathogenic Mutations: Naturally occurring mutations in Tmem126b are linked to isolated complex I deficiency, causing phenotypes such as cardiomyopathy, muscle weakness, and Leigh-like syndrome (LLS) .

4.1. Disease Modeling

Recombinant Tmem126b is used to:

  • Investigate mitochondrial disorders like LLS and hypertrophic cardiomyopathy .

  • Validate CRISPR/Cas9-edited models (e.g., AAV-based knockdown systems) .

Comparative Insights Across Species

SpeciesGene IDProtein FeaturesKey References
Mouse68472230 aa, mitochondrial transmembrane localization
Human55863230 aa, 97% sequence homology with mouse Tmem126b
Rat293114Similar functional role in complex I assembly

Research Limitations and Future Directions

  • Current Gaps: Structural details of Tmem126b’s transmembrane domains remain unresolved.

  • Therapeutic Potential: Gene therapy using AAV vectors (e.g., CRISPR systems ) to restore Tmem126b function in mitochondrial disorders is under exploration.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
Tmem126b; Complex I assembly factor TMEM126B, mitochondrial; Transmembrane protein 126B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem126b
Target Protein Sequence
MAASQRPSWSESKVAGVVQEGNREAPQDIKMALYKHGQLIPSLGDAKFRSPIISEIIEKK FEHYRNDKTLNIHGTLVFGTSSSLSGIMANLVFRNSFKVKYEALKTYASLTTLPVLATIV SYKLFVTDALQSGDISKESCVLRSALIGMACGVSYPSALAFYKNGRLAVKYQTVPLPPKG RVMLHWLLLCQTGMKAMAIPLFFQIVMGAFTGLHHYNICEKPRARLVPDD
Uniprot No.

Target Background

Function
A chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (Complex I). It plays a role in constructing the membrane arm of Complex I.
Database Links
Protein Families
TMEM126 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the basic function of TMEM126B in mitochondrial biology?

TMEM126B functions as an essential mitochondrial complex I assembly factor that is specifically required for formation of the membrane arm of complex I. It is a component of the mitochondrial complex I assembly (MCIA) complex, which includes other assembly factors such as ACAD9, Ecsit, and NDUFAF1 . Complexome profiling studies have demonstrated that TMEM126B co-migrates with these known assembly factors, providing evidence for its role in complex I biogenesis . This protein plays a crucial role in the early stages of membrane module assembly, particularly during integration of mitochondrial DNA-encoded subunits into the growing complex I structure.

How is TMEM126B structurally characterized?

TMEM126B is a transmembrane protein encoded by the nuclear genome. The gene is located on chromosome 11q14.1 in humans and consists of 7 exons . The protein contains multiple transmembrane domains that anchor it to the inner mitochondrial membrane, allowing it to facilitate the assembly of membrane-bound components of complex I. Unlike its paralog TMEM126A, which is associated with optic atrophy, TMEM126B has evolved specifically for complex I assembly functions in mammals .

What are the recommended storage conditions for recombinant Tmem126b protein?

For optimal stability, recombinant mouse Tmem126b protein should be stored at -20°C/-80°C. The shelf life is generally 6 months for liquid formulations and 12 months for lyophilized formulations at these temperatures . For working aliquots, storage at 4°C for up to one week is recommended. Repeated freezing and thawing should be avoided to maintain protein integrity . For reconstitution, the protein should be centrifuged briefly before opening, and then reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage .

What approaches can be used to study TMEM126B's role in complex I assembly?

Several complementary methodologies have proven effective for investigating TMEM126B's function:

  • Complexome Profiling: This mass-spectrometry-based approach provides unbiased insight into protein complex composition and allows detection of assembly intermediates. This technique effectively identified TMEM126B as part of the MCIA complex by analyzing similarities in migration patterns during blue-native gel electrophoresis .

  • Lentiviral Complementation Studies: Functional complementation using lentiviral expression of wild-type TMEM126B isoforms with FLAG tags can confirm causality of mutations. This approach has successfully demonstrated restoration of complex I assembly and activity in patient fibroblasts with TMEM126B mutations .

  • Two-dimensional BN-SDS-PAGE: This technique enables characterization of subassembled intermediates and can reveal molecular weight changes in TMEM126B-containing complexes when the protein is mutated or absent .

  • Co-immunoprecipitation: This method can identify direct protein interactions between TMEM126B and other complex I assembly factors or subunits.

How can researchers differentiate between the functions of TMEM126B and its paralog TMEM126A?

Distinguishing between TMEM126B and TMEM126A functions requires several targeted approaches:

  • Specific Knockout Models: Generate single and double knockout cell lines or animal models using CRISPR-Cas9 genome editing to assess individual and potentially compensatory functions.

  • Complementation Experiments: Express TMEM126A in TMEM126B-deficient cells and vice versa to determine functional overlap.

  • Interaction Profiling: Compare protein interaction partners using immunoprecipitation followed by mass spectrometry to identify unique versus shared interactors.

Research has shown that while TMEM126B functions in assembly of the ND2-module of complex I, TMEM126A is involved in the assembly of the ND4 distal membrane module . This functional distinction is critical for understanding their respective roles in mitochondrial disease mechanisms.

What clinical phenotypes are associated with TMEM126B mutations?

TMEM126B mutations have been associated with isolated complex I deficiency (mitochondrial complex I deficiency, nuclear type 29) . Interestingly, the clinical presentation in affected individuals can be relatively mild compared to other complex I defects.

Key clinical characteristics include:

Clinical FeatureDescription
Exercise intoleranceProgressive exercise-induced myalgia
Exercise-induced symptomsSymptoms occur primarily after physical exertion
Normal developmentPatients show normal later development despite mitochondrial defects
Age of onsetAdult subjects with relatively mild clinical symptoms

This milder phenotype compared to typical early-onset, severe mitochondrial disease suggests potential compensatory mechanisms or partial redundancy in complex I assembly pathways .

How do specific mutations in TMEM126B affect complex I assembly at the molecular level?

Research has identified several pathogenic TMEM126B mutations including c.635G>T (p.Gly212Val), c.397G>A (p.Asp133Asn), and c.208C>T (p.Gln70*) . These mutations disrupt complex I assembly at specific stages:

  • Membrane Module Assembly: TMEM126B mutations primarily affect the assembly of the membrane arm of complex I, leading to accumulation of subassemblies containing the Q and P modules.

  • Molecular Weight Alterations: Two-dimensional BN-SDS-PAGE analysis reveals reduced molecular weight of NDUFS3-containing modules in patient fibroblasts, indicating impaired assembly of individual CI functional modules.

  • Compensatory Mechanism: In some patients, the paralog TMEM126A appears to co-migrate with CI assembly factors (ACAD9 and NDUFAF1) in an apparent compensatory attempt, whereas in control fibroblasts, TMEM126A is not associated with any mitochondrial complex .

What methodological challenges exist in studying TMEM126B interactions with mtDNA-encoded complex I subunits?

Investigating interactions between nuclear-encoded TMEM126B and mitochondrial DNA-encoded complex I subunits presents several technical challenges:

  • Hydrophobicity of mtDNA-encoded Subunits: The extreme hydrophobicity of mitochondrial-encoded subunits like ND4 makes them difficult to solubilize while maintaining native interactions.

  • Temporal Nature of Interactions: Assembly factor interactions may be transient and occur only during specific assembly stages, requiring pulse-chase approaches for detection.

  • Multiple Isoforms: TMEM126B has multiple isoforms that may have different interaction profiles or functions, complicating analysis .

  • Compensation by Paralogs: Potential compensation by TMEM126A in TMEM126B-deficient cells may mask interaction defects .

Researchers should consider crosslinking approaches combined with proximity labeling and/or pulse-chase experiments to capture these challenging interactions.

How can complexome profiling be optimized for detecting TMEM126B-associated assembly intermediates?

Complexome profiling has been instrumental in identifying TMEM126B's role in complex I assembly, but several optimizations can enhance its utility:

  • Sample Preparation: Gentle solubilization conditions using digitonin rather than stronger detergents help preserve labile assembly intermediates.

  • Gel Resolution: Using large-pore blue-native gels improves separation of high molecular weight complexes (up to ~30 MDa) .

  • Mass Spectrometry Sensitivity: Employing high-sensitivity mass spectrometry is crucial, as some TMEM126B peptides may be difficult to detect (as noted in research where only certain isoforms were detectable by mass spectrometry) .

  • Comparative Analysis: Always include appropriate controls when analyzing complexome data from patient cells or knockdown experiments to identify specific changes in migration patterns.

  • Hierarchical Clustering: Apply hierarchical clustering to identify proteins with similar migration patterns, which can reveal functional associations .

What is the evolutionary significance of TMEM126B in complex I assembly?

TMEM126B represents an interesting case of evolutionary adaptation in complex I assembly machinery:

  • Recent Evolution: TMEM126B is evolutionary one of the most recent CI assembly factors and is present only in mammals, suggesting specialized adaptation to mammalian complex I requirements .

  • Duplication Event: TMEM126B arose from a duplication of its ancestor TMEM126A, with the two proteins sharing 85% similarity in their nucleotide sequences .

  • Functional Divergence: Despite their sequence similarity, TMEM126A and TMEM126B have diverged functionally, with TMEM126A associated with optic atrophy and TMEM126B with complex I assembly, demonstrating subfunctionalization after gene duplication .

This evolutionary history may explain why TMEM126A can partially compensate for TMEM126B deficiency in some contexts, providing insight into the relatively mild phenotypes observed in some patients with TMEM126B mutations.

What control experiments are essential when using recombinant Tmem126b in functional studies?

When conducting functional studies with recombinant mouse Tmem126b, several critical controls should be included:

  • Heat-inactivated Protein Control: To distinguish between specific protein activity and non-specific effects.

  • Empty Vector Control: For complementation studies, cells transduced with empty vector provide the baseline for comparison.

  • Isoform Controls: Given that TMEM126B has multiple isoforms (with at least three documented in complementation studies), testing all relevant isoforms is important as they may have different functionalities .

  • Negative Control Cell Lines: Include cells lacking expression of interaction partners to validate specificity.

  • Positive Control Interactions: Include known interaction partners (ACAD9, Ecsit, NDUFAF1) as positive controls for interaction studies .

How should researchers approach contradictory data regarding TMEM126B localization or interactions?

When faced with conflicting data about TMEM126B localization or interaction partners:

  • Consider Isoform Differences: Different TMEM126B isoforms may localize differently or have distinct interaction profiles. Studies have identified at least three isoforms that can partially restore CI assembly when expressed in patient fibroblasts .

  • Evaluate Cell Type Specificity: TMEM126B function may vary between tissues or cell types. Compare results across multiple cell lines.

  • Assess Technical Approaches: Different solubilization methods, detergents, or antibodies can dramatically affect results. Cross-validate findings using complementary techniques.

  • Examine Disease State: The behavior of TMEM126B may change in disease states. For example, its paralog TMEM126A associates with CI assembly factors only in TMEM126B-deficient cells but not in control fibroblasts .

  • Consider Quantitative Differences: Some interactions may be stoichiometric while others are substoichiometric, affecting detection sensitivity.

What are promising targets for therapeutic development in TMEM126B-associated disorders?

Several approaches show potential for addressing TMEM126B deficiency:

  • Gene Therapy: Delivery of functional TMEM126B cDNA could restore complex I assembly, as demonstrated by successful lentiviral complementation in patient fibroblasts .

  • Paralog Upregulation: Enhancing TMEM126A expression might compensate for TMEM126B deficiency, given evidence that TMEM126A can associate with complex I assembly factors in TMEM126B-deficient cells .

  • Bypass Therapies: Alternative electron transfer pathways could bypass complex I deficiency, such as targeting complex II substrates or alternative NADH oxidation systems.

  • Exercise Therapy: The observation that symptoms in some patients manifest primarily after exercise suggests that appropriate exercise protocols might induce beneficial adaptations in mitochondrial function .

  • Metabolic Modulation: Targeting metabolic pathways that reduce NADH/NAD+ ratios could potentially alleviate consequences of complex I deficiency.

How might integrated multi-omics approaches advance understanding of TMEM126B function?

Integrating multiple omics technologies could provide comprehensive insights into TMEM126B biology:

  • Proteomics + Transcriptomics: Combining proteome analysis with transcriptional profiling in TMEM126B-deficient models can identify compensatory responses and regulatory networks.

  • Metabolomics + Proteomics: Correlating metabolic alterations with changes in protein expression or complex assembly could reveal functional consequences of TMEM126B deficiency.

  • Structural Biology + Interactomics: Integrating structural information with protein interaction data could define the precise molecular mechanisms of TMEM126B in complex I assembly.

  • Single-cell Analysis: Applying single-cell technologies could reveal cell-to-cell variability in TMEM126B function and compensatory mechanisms, potentially explaining the variable penetrance of disease phenotypes.

  • Temporal Dynamics: Time-resolved omics approaches could elucidate the sequential assembly steps mediated by TMEM126B during complex I biogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.