Recombinant Mouse Transmembrane protein 129 (Tmem129)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Transmembrane Protein 129 (Tmem129)

Recombinant Mouse Transmembrane Protein 129, also known as Tmem129, is a protein that has garnered significant attention in recent years due to its role as an E3 ubiquitin ligase. This enzyme plays a crucial part in the endoplasmic reticulum-associated degradation (ERAD) pathway, which is essential for the quality control of proteins within the cell. Tmem129 is particularly noted for its involvement in the downregulation of major histocompatibility complex class I (MHC-I) molecules, a process exploited by certain viruses to evade the immune system.

Role in ERAD Pathway

Tmem129 functions as a key component of the ERAD pathway, which is responsible for identifying and removing misfolded or aberrant proteins from the endoplasmic reticulum. It works in conjunction with other proteins to ensure that only properly folded proteins are secreted or integrated into cellular membranes, while misfolded proteins are targeted for degradation . This process is vital for maintaining cellular homeostasis and preventing the accumulation of toxic protein aggregates.

Involvement in Viral Immune Evasion

One of the most significant roles of Tmem129 is its involvement in the downregulation of MHC-I molecules mediated by viral proteins such as US11 from human cytomegalovirus (HCMV) . By facilitating the degradation of MHC-I, viruses can evade recognition by the immune system, thereby enhancing their ability to infect and replicate within host cells. Tmem129 is essential for this process, as its absence prevents the efficient downregulation of MHC-I .

5.1. Experimental Validation

Experimental studies have validated the membrane topology of Tmem129 using techniques such as in vitro translation, truncation scanning, and glycosylation scanning mutagenesis . These studies have confirmed that Tmem129 contains three transmembrane domains and lacks glycosylation, which is consistent with its role as an ER-resident E3 ligase.

5.2. Functional Assays

Functional assays have demonstrated the necessity of Tmem129 in the US11-mediated downregulation of MHC-I. Depletion of Tmem129 results in the rescue of MHC-I expression on the cell surface, highlighting its critical role in this process .

5.3. Data Table: Characteristics of Tmem129

CharacteristicDescription
Transmembrane DomainsThree domains with N-exo-C-cyto orientation
RING DomainC-terminal, located in the cytosol, essential for E3 ubiquitin ligase activity
Role in ERADKey component in the ERAD pathway for protein quality control
Viral Immune EvasionEssential for US11-mediated downregulation of MHC-I

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem129; E3 ubiquitin-protein ligase TM129; RING-type E3 ubiquitin transferase TM129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-362
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem129
Target Protein Sequence
EFYSAGLTVQNLLSGWLGSEDAAFVPYHLRRTSATLLCHSLLPLGYYMGMCFAASEKQLY SPGQAPEAWQLFLLLAVTLPLLSCTLIYYWSWDRWTRHPLAQTLALYALPQSGWQAVASS INTEFRRIDKFATGAPGARVIVTDTWVMKVTTYRVHVAQQQDVHLTVTESRQHDLSPDSN LPVQLLTIRVASTSPGTQPFDIRLNSSEYGELCEKLHAPIRSAANVVIRQSLGDLFLETF ASHVEVNPAYSVPSNQELEPCIGCMQTRASVKLVKTCQEPAVGECQQCYCRPMWCLTCMG KWFASRQDPQRPDTWLASRVPCPTCRARFCILDVCCVR
Uniprot No.

Target Background

Function

E3 ubiquitin-protein ligase involved in ER-associated protein degradation. It preferentially associates with the E2 enzyme UBE2J2 and is exploited by viral US11 proteins to mediate HLA class I protein degradation.

Database Links
Protein Families
TMEM129 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Tmem129 and how is it organized?

Tmem129 is an evolutionarily conserved polytopic membrane protein with three transmembrane domains and a long C-terminal tail. Bioinformatic analysis reveals that while lacking any yeast ortholog, Tmem129 can be traced back to the unicellular metazoan ancestor Capsaspora owczarzaki . The protein contains approximately 362 amino acids and is primarily localized to the endoplasmic reticulum (ER), as confirmed by colocalization studies with ER markers such as calnexin .

The most distinctive structural feature of Tmem129 is its C-terminal domain, which contains conserved cysteine residues arranged in a pattern reminiscent of RING (Really Interesting New Gene) E3 ligases. Unlike classical RING domains that contain both cysteine and histidine residues for zinc coordination in a C3HC4 (RING-CH) or C3H2C3 (RING-H2) arrangement, Tmem129 possesses an unusual "cysteine-only" RING domain (RING-C2) . This domain contains extended loops between its zinc-coordinating cysteines (amino acids 289-308 and 323-345) and includes canonical E2 binding motifs necessary for its ligase function .

What is the primary function of Tmem129 in cellular processes?

Tmem129 functions as an E3 ubiquitin ligase within the endoplasmic reticulum-associated degradation (ERAD) pathway. This critical quality control mechanism targets misfolded secretory proteins for ubiquitination and subsequent proteasomal degradation . Tmem129 plays an essential role in this process by catalyzing the transfer of ubiquitin to substrate proteins, marking them for dislocation from the ER to the cytosol and subsequent degradation by the proteasome .

The functional significance of Tmem129 has been particularly highlighted through its interaction with viral proteins. Human cytomegalovirus (HCMV) hijacks Tmem129 via its US11 protein to degrade MHC class I molecules, thereby evading immune recognition . This mechanism demonstrates the critical role of Tmem129 in protein quality control and its potential importance in immune regulation.

What are the optimal methods for expressing and purifying recombinant mouse Tmem129?

For effective expression and purification of recombinant mouse Tmem129, researchers should consider several methodological approaches based on the protein's membrane-bound nature and functional domains:

For full-length Tmem129:

  • Expression systems: Mammalian expression systems (HEK293 or CHO cells) are recommended due to Tmem129's multiple transmembrane domains and potential requirement for eukaryotic post-translational modifications.

  • Detergent solubilization: Use mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) to extract the protein while maintaining its native conformation.

For soluble C-terminal RING domain:

  • Bacterial expression: The C-terminal domain containing the RING-C2 ligase activity can be expressed as a GST-fusion protein in E. coli as demonstrated in the literature .

  • Affinity purification: GST-based affinity chromatography has been successfully employed to purify both the minimal RING domain and the complete C-terminal portion of Tmem129 for functional studies .

For functional verification, in vitro autoubiquitination assays should be performed to confirm E3 ligase activity, similar to the approaches used in the literature where GST-TMEM129 constructs were incubated with E1 activating enzyme, E2 conjugating enzyme (such as UbcH5), and ubiquitin to demonstrate robust autoubiquitination .

How can I design experiments to assess the E3 ligase activity of recombinant mouse Tmem129?

To effectively assess the E3 ligase activity of recombinant mouse Tmem129, implement a multi-faceted experimental approach:

  • In vitro autoubiquitination assays:

    • Express and purify either the minimal RING domain or the soluble C-terminal portion of Tmem129 as GST fusion proteins .

    • Incubate the purified protein with E1 activating enzyme, appropriate E2 conjugating enzymes (initial screening should include UbcH5, but Ube2J2 should be specifically tested based on published data), ATP, and ubiquitin .

    • Detect autoubiquitination via Western blotting using anti-ubiquitin antibodies.

    • Include controls with mutated zinc-coordinating cysteine residues in the RING domain to confirm specificity .

  • Cell-based ubiquitination assays:

    • Establish a cell system expressing your substrate of interest and Tmem129.

    • Immunoprecipitate the substrate under standard or denaturing conditions.

    • Perform Western blotting with anti-ubiquitin antibodies to detect substrate ubiquitination .

    • Compare ubiquitination patterns between wild-type Tmem129 and RING domain mutants.

    • Include Tmem129 knockdown/knockout controls to confirm specificity .

  • E2 conjugase identification:

    • Conduct a systematic screen of E2 conjugating enzymes using siRNA libraries targeting annotated E2s .

    • Focus particularly on ER-associated E2s such as Ube2J1 and Ube2J2 based on published evidence .

    • Validate hits through rescue experiments in Tmem129-depleted cells.

  • Substrate degradation kinetics:

    • Perform pulse-chase experiments to measure the half-life of putative Tmem129 substrates.

    • Compare degradation rates in the presence of wild-type Tmem129, RING mutants, or after Tmem129 depletion .

    • Include proteasome inhibitors to confirm the degradation pathway.

How does mouse Tmem129 recognize its substrates and what are its known targets?

Mouse Tmem129 substrate recognition involves a complex interplay of protein interactions within the ER membrane environment. While direct binding studies with mouse Tmem129 have limitations, insights from human TMEM129 research provide a valuable framework:

Tmem129 appears to function within a multiprotein ERAD complex that includes Derlin-1, a key component for substrate recognition and recruitment . The specific mechanism likely involves:

  • Initial substrate recognition: Misfolded proteins are first recognized by ER quality control machinery including chaperones and lectins.

  • Derlin-1 association: Evidence from human studies shows that Tmem129 associates with Derlin-1, which acts as an adapter to connect Tmem129 to its substrates . This interaction is crucial for Tmem129 recruitment to substrate proteins.

  • RING domain interaction: The C-terminal RING-C2 domain of Tmem129 then facilitates the recruitment of the E2 conjugase Ube2J2, enabling substrate ubiquitination .

Known and potential substrates include:

  • MHC class I heavy chains: In viral hijacking scenarios, HCMV US11 redirects Tmem129 to ubiquitinate MHC-I molecules, targeting them for degradation .

  • Misfolded secretory proteins: As an ERAD E3 ligase, Tmem129 likely targets various endogenous misfolded proteins that accumulate in the ER .

The substrate specificity appears to involve both protein-protein interactions (via Derlin-1) and potential recognition of specific structural features in misfolded proteins. Additional specific endogenous substrates remain to be fully characterized through systematic proteomic approaches.

How does Tmem129 coordinate with other components of the ERAD pathway?

Tmem129 functions as a central component within a specialized ERAD complex, coordinating with multiple proteins to facilitate the recognition, ubiquitination, and dislocation of substrate proteins. This coordination involves:

  • Membrane dislocation machinery:

    • Tmem129 associates with Derlin-1, a critical component of the ERAD dislocation machinery .

    • This association is essential for Tmem129's ability to access and ubiquitinate substrates targeted for degradation.

    • In the absence of Tmem129, substrates remain bound to their recognition factors (as seen with MHC-I remaining bound to US11) but fail to be dislocated to the cytosol .

  • E2 conjugase recruitment:

    • Tmem129 specifically recruits the ER-membrane tail-anchored E2 ubiquitin conjugase Ube2J2 through its RING-C2 domain .

    • This recruitment is highly specific, as depletion studies show that Ube2J2, but not the related Ube2J1, is essential for Tmem129-mediated ubiquitination .

    • The specificity is likely determined by the unusual structure of Tmem129's RING domain.

  • Parallel ERAD pathways:

    • Evidence suggests that Tmem129 functions within a distinct ERAD complex that operates in parallel to the well-characterized HRD1/SEL1L complex .

    • Research demonstrates that while Tmem129 is essential for certain substrates (like US11-bound MHC-I), the HRD1/SEL1L complex targets others (like unbound US11) .

    • This parallel pathway organization allows for substrate-specific regulation and processing.

  • Proteasome targeting:

    • Following Tmem129-mediated ubiquitination, substrates are dislocated through the ER membrane to the cytosol.

    • In the cytosol, the N-glycanase enzyme removes glycans from dislocated glycoproteins, creating characteristic deglycosylated intermediates that can be detected upon proteasome inhibition .

    • These deglycosylated intermediates represent the final stage before proteasomal degradation.

What is the evolutionary significance of the unusual "cysteine-only" RING domain in Tmem129?

The unusual "cysteine-only" RING-C2 domain found in Tmem129 represents a fascinating evolutionary adaptation with significant functional implications:

Structural uniqueness:

  • Unlike classical RING domains that contain both cysteine and histidine residues for zinc coordination (C3HC4 or C3H2C3 arrangements), Tmem129's RING domain uses only cysteine residues .

  • This RING-C2 domain also features extended loops between zinc-coordinating cysteines (amino acids 289-308 and 323-345), creating a unique structural arrangement .

  • Such "cysteine-only" RINGs are rare in the human proteome, with examples including cNOT4, RFPL family proteins, and some RBR ligases like HOIP and RNF216 .

Evolutionary origin:

  • Phylogenetic analysis suggests that Tmem129's RING-C2 domain likely evolved from a classic RING domain rather than arising independently .

  • The conservation of this unusual domain structure across species indicates its functional importance and suggests selective pressure to maintain this specific arrangement.

  • The domain's closer homology to RING-HC domains than to other RING-C2 domains (like cNOT4) supports the hypothesis of its derivation from classical RING domains .

Functional implications:

  • The unique structure of Tmem129's RING domain likely influences its E2 conjugase specificity, particularly its preference for Ube2J2 .

  • This specificity may enable unique ubiquitination patterns, potentially including non-canonical ubiquitination (such as non-lysine ubiquitination mentioned in the literature) .

  • The domain's structure may also influence substrate recognition or regulatory interactions specific to the ERAD pathway.

Evolutionary advantage:

  • The persistence of this unusual domain structure suggests it confers specific advantages in ERAD processes.

  • It may represent an adaptation that allows Tmem129 to function effectively in the specialized environment of the ER membrane.

  • The domain's properties might be particularly suited for recognizing and processing specific classes of misfolded proteins.

What are effective approaches for studying Tmem129 knockout or knockdown effects in mouse models?

To effectively study Tmem129 knockout or knockdown effects in mouse models, researchers should implement a comprehensive experimental strategy:

Genetic modification approaches:

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs targeting early exons of Tmem129.

    • Confirm knockout by sequencing and protein detection using Tmem129-specific antibodies.

    • Consider conditional knockout strategies (Cre-loxP system) if complete knockout proves embryonically lethal.

  • siRNA/shRNA knockdown:

    • For temporary or tissue-specific depletion, design siRNAs targeting conserved regions of Tmem129 mRNA.

    • Validate knockdown efficiency by qPCR and Western blotting .

    • Consider inducible shRNA systems for temporal control of knockdown.

Functional validation approaches:

  • Substrate fate tracking:

    • Perform pulse-chase analysis to monitor degradation rates of putative Tmem129 substrates in wild-type versus knockout/knockdown cells .

    • Look for accumulation of substrate proteins in the ER using subcellular fractionation and immunofluorescence microscopy.

  • Ubiquitination assays:

    • Immunoprecipitate substrate proteins and assess ubiquitination status by Western blotting .

    • Compare ubiquitination patterns between wild-type and Tmem129-deficient cells under both normal and stress conditions.

  • ER stress response analysis:

    • Monitor ER stress markers (e.g., BiP, CHOP, XBP1 splicing) to assess the impact of Tmem129 deficiency on ER homeostasis.

    • Challenge cells with ER stressors (tunicamycin, thapsigargin) to reveal potential compensatory mechanisms.

Rescue experiments:

  • Complementation studies:

    • Reintroduce wild-type Tmem129 to confirm phenotype reversal.

    • Test mutant versions (particularly RING domain mutants) to identify essential functional domains .

    • Use domain-swapping approaches to investigate the specificity of Tmem129's functions.

How can researchers identify novel substrates and interaction partners of mouse Tmem129?

Identifying novel substrates and interaction partners of mouse Tmem129 requires a multi-faceted approach combining proteomics, biochemical techniques, and functional validation:

Interaction partner identification:

  • Proximity-dependent labeling approaches:

    • Generate BioID or TurboID fusion constructs with Tmem129 to identify proteins in close proximity within the cellular environment.

    • This approach is particularly valuable for membrane proteins like Tmem129 where traditional immunoprecipitation may disrupt important interactions.

    • Analyze labeled proteins by mass spectrometry and prioritize ER-resident proteins or ERAD components.

  • Co-immunoprecipitation with catalytically inactive mutants:

    • Use Tmem129 RING domain mutants (cysteine mutations) as "substrate traps" to stabilize normally transient E3-substrate interactions .

    • Perform immunoprecipitation under various detergent conditions to preserve membrane protein interactions.

    • Consider crosslinking approaches to capture weak or transient interactions.

Substrate identification:

  • Global proteomics approaches:

    • Compare protein abundance in wild-type versus Tmem129-deficient cells using quantitative proteomics.

    • Focus specifically on ER-resident proteins and secretory pathway components.

    • Apply ubiquitin remnant profiling to identify proteins with altered ubiquitination in Tmem129-deficient cells.

  • Degron-based approaches:

    • Generate fluorescent reporter constructs containing putative degradation signals.

    • Screen for stabilization of these reporters in Tmem129-deficient backgrounds.

    • Validate hits by direct ubiquitination assays.

  • ERAD substrate screens:

    • Introduce known ERAD substrates and assess their dependence on Tmem129 for degradation.

    • Use pulse-chase analysis to quantify degradation kinetics in the presence or absence of Tmem129 .

    • Compare Tmem129-dependent degradation with degradation mediated by other ERAD E3 ligases like HRD1/SEL1L .

Validation methods:

  • Direct ubiquitination assays:

    • Reconstitute Tmem129-mediated ubiquitination in vitro using purified components.

    • Include E1, Ube2J2 as the E2 conjugase, recombinant Tmem129, and candidate substrates .

    • Analyze ubiquitination patterns using Western blotting or mass spectrometry.

  • Cellular validation:

    • Perform genetic epistasis experiments by depleting both Tmem129 and other ERAD components.

    • Use fluorescence microscopy to track substrate localization in the presence or absence of Tmem129.

    • Employ cycloheximide chase experiments to confirm effects on protein stability.

What are common challenges in expressing and purifying functional Tmem129 and how can they be overcome?

Researchers working with recombinant mouse Tmem129 face several technical challenges due to its membrane-bound nature and functional requirements. Here are the major challenges and recommended solutions:

Challenge 1: Low expression levels

  • Problem: Membrane proteins like Tmem129 often express poorly in heterologous systems.

  • Solutions:

    • Optimize codon usage for the expression system.

    • Try different expression tags (N-terminal vs. C-terminal) being careful not to disrupt the RING domain.

    • Test inducible expression systems with lower expression rates to prevent toxicity.

    • Use specialized host strains designed for membrane protein expression.

    • Consider fusion partners that enhance membrane protein expression (e.g., GFP, MBP).

Challenge 2: Protein misfolding and aggregation

  • Problem: Tmem129's multiple transmembrane domains make proper folding challenging.

  • Solutions:

    • Lower expression temperature to slow protein production and facilitate proper folding.

    • Co-express with chaperones specific for membrane proteins.

    • Try expression in eukaryotic systems (insect cells, mammalian cells) that better support complex membrane protein folding.

    • For the RING domain alone, express as a soluble fragment fused to GST or other solubility enhancers .

Challenge 3: Maintaining activity during purification

  • Problem: Detergent solubilization can disrupt protein structure and function.

  • Solutions:

    • Screen different detergents systematically (from harsh to mild) to find optimal extraction conditions.

    • Consider native nanodiscs or styrene maleic acid lipid particles (SMALPs) to maintain the lipid environment.

    • Perform functional assays (e.g., autoubiquitination) quickly after purification .

    • Include zinc in buffers to maintain RING domain structure.

    • Consider on-column ubiquitination assays to test activity before extensive purification.

Challenge 4: Verifying functional integrity

  • Problem: Ensuring the purified protein retains its E3 ligase activity.

  • Solutions:

    • Develop robust in vitro autoubiquitination assays using different E2 enzymes, particularly Ube2J2 .

    • Include positive controls (known active E3 ligases) and negative controls (mutated RING domain) .

    • Confirm protein folding using circular dichroism or limited proteolysis.

    • Test activity with putative substrate proteins if available.

How can researchers address contradictory data when studying Tmem129 function?

When confronted with contradictory data in Tmem129 research, a systematic troubleshooting approach can help resolve discrepancies and advance understanding:

Methodological inconsistencies:

  • Protein expression variability:

    • Verify protein expression levels across experiments using quantitative Western blotting.

    • Ensure consistent expression of both wild-type and mutant proteins, as variation in expression levels can lead to contradictory functional data .

    • Consider that overexpression can cause artificial interactions or pathway saturation.

  • Differential knockdown/knockout efficiency:

    • Quantify the degree of Tmem129 depletion in each experimental system.

    • Partial knockdowns may yield different phenotypes compared to complete knockouts.

    • Validate knockdown/knockout using both mRNA and protein detection methods .

Biological context differences:

  • Cell type-specific effects:

    • Compare results across different cell types, as Tmem129 function may vary with cellular context.

    • Consider that different cells may have varying levels of redundant E3 ligases or substrate processing pathways.

    • The importance of Tmem129 may be more pronounced in specialized cells with high secretory activity.

  • Species-specific variations:

    • Directly compare mouse and human Tmem129 function in the same experimental system.

    • Consider that substrates may show different dependencies on Tmem129 across species.

    • Ensure antibodies and detection methods are species-appropriate.

Experimental design considerations:

  • Substrate-specific effects:

    • Recognize that Tmem129 may show substrate selectivity, as seen with US11-bound MHC-I versus free US11 .

    • Different experimental setups may inadvertently focus on different substrate pools.

    • Use multiple substrates to get a comprehensive picture of Tmem129 function.

  • Pathway redundancy:

    • Investigate potential compensatory mechanisms from other ERAD E3 ligases like HRD1/SEL1L .

    • Consider double knockdown/knockout experiments to reveal redundant functions.

    • Examine acute versus chronic loss of Tmem129 to identify adaptation responses.

Resolution strategies:

  • Epistasis experiments:

    • Systematically deplete components upstream and downstream of Tmem129 to place contradictory observations in pathway context.

    • Test specific interaction partners like Derlin-1 to confirm mechanism .

    • Examine E2 conjugase dependencies, particularly Ube2J2 versus Ube2J1 .

  • Domain-specific analysis:

    • Use structure-function studies with specific domain mutants to pinpoint the source of contradictions.

    • Focus particularly on the RING domain and transmembrane regions .

    • Consider that different mutations might affect distinct functions of Tmem129.

  • Temporal dynamics:

    • Implement time-course experiments to capture acute versus chronic effects.

    • Use pulse-chase analysis to distinguish effects on different stages of substrate processing .

    • Consider inducible systems to control the timing of Tmem129 loss or expression.

How might Tmem129 function beyond ERAD in cellular homeostasis and disease?

While Tmem129 is primarily characterized as an ERAD E3 ligase, emerging evidence suggests potential broader functions in cellular homeostasis and disease:

ER stress response integration:
Tmem129's role in protein quality control positions it as a potential regulator of the integrated stress response. Beyond simple misfolded protein elimination, Tmem129 may:

  • Serve as a sensor for specific classes of misfolded proteins

  • Contribute to the adaptive capacity of cells under persistent ER stress

  • Function in specialized secretory cells with high protein folding demands

Immune system regulation:
The exploitation of Tmem129 by viruses suggests its potential importance in normal immune function:

  • The ability of HCMV US11 to redirect Tmem129 to degrade MHC-I molecules indicates Tmem129 might play roles in antigen presentation or immune regulation

  • The specificity for MHC-I degradation through Derlin-1 association suggests potential physiological substrates related to immune function

  • Tmem129 may participate in regulating inflammatory responses by controlling the turnover of immune signaling components

Neurodegenerative disease relevance:
Given the central role of protein misfolding in neurodegenerative diseases, Tmem129 may have specific implications:

  • Potential involvement in clearing disease-associated misfolded proteins

  • Possible dysregulation of Tmem129 function contributing to protein aggregation diseases

  • The unique "cysteine-only" RING domain may confer special substrate specificity relevant to neuronal proteins

Cancer and cell proliferation:
E3 ligases frequently play roles in cell cycle regulation and cancer:

  • Tmem129 might regulate the turnover of proteins involved in cell growth or division

  • Cancer cells, which often experience heightened ER stress, may depend on Tmem129 function for survival

  • Alterations in Tmem129 expression or function could potentially contribute to cancer development or progression

Metabolic regulation:
The ERAD system increasingly appears linked to metabolic control:

  • Tmem129 may participate in regulating key metabolic enzymes or transporters

  • Its activity might be modulated in response to nutrient availability or metabolic stress

  • Specialized secretory tissues involved in hormone production might particularly depend on Tmem129 function

What technological advances would enhance our ability to study Tmem129 function?

Several technological advances would significantly enhance our ability to study Tmem129 function and overcome current research limitations:

Structural biology approaches:

  • Cryo-EM for membrane protein complexes:

    • Determining the full structure of Tmem129 in its membrane environment would revolutionize our understanding of its mechanism.

    • Capturing Tmem129 in complex with Derlin-1, Ube2J2, and substrates would reveal critical interaction interfaces.

    • The unusual RING-C2 domain structure could be fully characterized, informing both evolutionary and functional analyses .

  • Mass spectrometry advances:

    • Improved crosslinking mass spectrometry techniques would help map dynamic interactions in the Tmem129 complex.

    • Native mass spectrometry of membrane protein complexes could reveal the stoichiometry and organization of Tmem129-containing complexes.

    • Hydrogen-deuterium exchange mass spectrometry could identify conformational changes upon substrate or E2 binding.

Proteomics and substrate identification:

  • Proximity-dependent labeling optimization:

    • Development of membrane-optimized BioID or TurboID variants would improve identification of transient Tmem129 interactions.

    • Targeted proximity labeling of specific Tmem129 domains could distinguish different functional interactions.

    • Time-resolved proximity labeling would help order the sequence of interactions during substrate processing.

  • Ubiquitination site mapping:

    • Enhanced methods for identifying non-canonical ubiquitination (e.g., on serine/threonine) would help characterize Tmem129 specificity .

    • Development of antibodies specific to different ubiquitin chain linkages would clarify the types of ubiquitin modifications catalyzed by Tmem129.

    • Improved methods for capturing ubiquitinated membrane proteins would facilitate comprehensive substrate identification.

Cellular and in vivo approaches:

  • Advanced genome editing:

    • Base editing or prime editing technologies would allow precise introduction of point mutations to study specific Tmem129 domains.

    • Tissue-specific and inducible CRISPR systems would enable temporal and spatial control of Tmem129 manipulation.

    • Knock-in of endogenous tags would facilitate tracking of Tmem129 without overexpression artifacts.

  • Live-cell imaging advances:

    • Development of sensors for monitoring E3 ligase activity in real-time would transform our understanding of Tmem129 dynamics.

    • Super-resolution microscopy optimized for ER membrane proteins would reveal the spatial organization of Tmem129 complexes.

    • Correlative light and electron microscopy could connect Tmem129 function to ER membrane remodeling during ERAD.

Biochemical reconstitution:

  • Membrane protein nanodiscs:

    • Improved nanodisc technologies would enable functional reconstitution of the complete Tmem129 complex.

    • This would allow detailed mechanistic studies of substrate recognition, ubiquitination, and dislocation.

    • The ability to control membrane composition would reveal lipid dependencies of Tmem129 function.

  • Cell-free expression systems:

    • Advanced cell-free systems capable of producing functional membrane proteins would accelerate Tmem129 research.

    • Coupled transcription-translation-insertion systems would enable high-throughput mutational analysis.

    • Incorporation of site-specific probes during synthesis would facilitate detailed mechanistic studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.