Recombinant Mouse Transmembrane protein 140 (Tmem140)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Transmembrane Protein 140 (Tmem140)

Recombinant Mouse Transmembrane Protein 140 (Tmem140) is a protein of interest in various biological studies, particularly in the context of cellular processes and disease models. Despite the limited availability of specific information on recombinant versions of this protein, Tmem140 itself has been studied for its role in cellular functions and disease prognosis.

Overview of Tmem140

Tmem140, or Transmembrane Protein 140, is a protein associated with cellular membranes. Research on Tmem140 has primarily focused on its expression and role in disease models, such as glioma, where it influences cell viability, migration, and invasion . The protein's involvement in cell adhesion and apoptosis pathways suggests its potential impact on cellular behavior and disease progression.

Role in Glioma

Studies have shown that Tmem140 expression is a prognostic factor for glioma patients. High expression levels of Tmem140 correlate with poorer patient outcomes, indicating its role in tumor progression . The protein's involvement in cell adhesion molecules and apoptosis pathways further supports its significance in glioma development.

Expression and Regulation

Tmem140 expression can be influenced by various factors, including environmental toxins and drugs. For example, 2,3,7,8-tetrachlorodibenzodioxin (TCDD) has been shown to both increase and decrease Tmem140 expression depending on the context . This variability highlights the complex regulation of Tmem140 and its potential sensitivity to external factors.

Impact on Cell Behavior

Knockdown of Tmem140 in glioma cells results in reduced cell adhesion, migration, and invasion capabilities. Additionally, Tmem140 silencing leads to increased apoptosis, suggesting its role in maintaining cell survival and promoting aggressive cellular behavior .

Data Tables

While specific data tables for recombinant Mouse Tmem140 are not readily available, the following table summarizes key findings related to Tmem140 expression and its impact on glioma cells:

ParameterCharacteristicTMEM140 ExpressionP Value
Age (years)≥55High: 27, Low: 130.6164
<55High: 18, Low: 12
GenderMaleHigh: 16, Low: 100.5990
FemaleHigh: 31, Low: 13
Tumor Size≥4.5 cmHigh: 20, Low: 170.0211*
<4.5 cmHigh: 27, Low: 6
WHO GradeI/IIHigh: 15, Low: 150.0108*
III/IVHigh: 32, Low: 8

*P < 0.05 indicates statistical significance.

References

- TMEM140 is associated with the prognosis of glioma by promoting viability, migration, and invasion of glioma cells.
- Rat Genome Database: Tmem140 (transmembrane protein 140).
- NCBI Gene: TMEM140 transmembrane protein 140 [Homo sapiens].

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate them in your order remarks. We will strive to accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. We recommend reaching out to your local distributors for specific delivery estimates.
All our proteins are shipped standard with blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
Tmem140; Transmembrane protein 140
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem140
Target Protein Sequence
MAFSRLWRNNHLPFVGIMILLAAALCLMFYALLWKAGNLADLPSLRIGFYNFCLWKEDMG SLACYNFPELDVLGIPQVGLALARLGVYGALVLTVFVPLPLLLAQYNRDEGEWRLAVCFL AASSILLAGGLSLFLSFVWKWLRLSFLGPALPALCLAQLLLIFLLVATVRFPPRDKEDKN QWENC
Uniprot No.

Target Background

Database Links

KEGG: mmu:68487

UniGene: Mm.248440

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane Protein 140 and how is it characterized?

Transmembrane protein 140 (Tmem140) is a protein-coding gene that encodes a membrane-spanning protein. Based on comparative studies with other species, such as Xenopus tropicalis, Tmem140 produces multiple transcript variants that encode the same protein . The protein is relatively conserved across species, suggesting important biological functions.

For characterization of mouse Tmem140:

  • Sequence analysis using NCBI Reference Sequence Database is essential for identifying transcript variants

  • Protein topology prediction tools can determine transmembrane domains

  • Subcellular localization studies using fluorescent-tagged constructs help establish cellular distribution

Mouse Tmem140 characterization would typically include:

Analysis TypeMethodExpected Outcome
Gene structureGenomic analysisIdentification of exons, introns, regulatory regions
Protein topologyBioinformatic predictionNumber and position of transmembrane domains
Expression profilingqRT-PCR/RNA-seqTissue distribution and expression levels
Protein detectionWestern blot/IHCProtein size validation and localization

What expression patterns does Tmem140 exhibit in normal mouse tissues?

While direct mouse Tmem140 expression data isn't provided in the search results, expression analysis approaches should include:

  • Comprehensive tissue panel analysis using quantitative RT-PCR to determine baseline expression

  • Immunohistochemistry to visualize protein distribution in tissues

  • RNA-sequencing analysis for transcript variant identification

From analogous studies in humans, Tmem140 likely shows differential expression across tissues, with particularly notable expression patterns in neural tissues. When characterizing expression patterns, researchers should:

  • Establish appropriate housekeeping genes for normalization

  • Compare expression across developmental stages

  • Analyze expression in different physiological conditions

  • Consider both mRNA and protein levels, as they may not directly correlate

How should recombinant mouse Tmem140 be produced for experimental studies?

Production of recombinant mouse Tmem140 requires careful consideration of expression systems:

  • Vector selection:

    • Standard vectors like pcDNA3.1 are suitable for mammalian expression

    • Consider adding epitope tags (His, FLAG, etc.) for purification and detection

    • Include appropriate promoters for desired expression levels

  • Expression systems:

    • Mammalian cells (HEK293, CHO) for proper folding and post-translational modifications

    • Bacterial systems for higher yield but potential protein folding issues

    • Insect cell systems as an intermediate option

  • Purification strategy:

    • Detergent screening for optimal membrane protein solubilization

    • Affinity chromatography using epitope tags

    • Size exclusion chromatography for final purification

  • Quality control:

    • SDS-PAGE and Western blot for size verification

    • Mass spectrometry for identity confirmation

    • Functional assays to verify biological activity

What methodologies are most effective for studying Tmem140 function in mouse models?

Based on approaches used for human TMEM140, effective methodologies include:

  • Gene silencing approaches:

    • siRNA transfection in cell models (effectiveness verified by Western blot and RT-PCR)

    • shRNA for stable knockdown

    • CRISPR/Cas9 for complete knockout

  • Overexpression studies:

    • Transient transfection for acute effects

    • Stable cell lines for long-term studies

    • Inducible expression systems for temporal control

  • In vivo models:

    • Conditional knockout mice to avoid developmental effects if lethal

    • Tissue-specific expression using Cre-lox systems

    • Xenograft models for tumor studies as demonstrated with human TMEM140

  • Functional assays:

    • Cell viability assays (e.g., Cell Counting Kit-8)

    • Migration and invasion assays (e.g., Transwell assays)

    • Cell cycle analysis and apoptosis assays using flow cytometry

When designing Tmem140 knockout models, researchers should be aware of potential off-target effects, especially considering possible gene paralogs. Validation through multiple founder lines and complementation studies is essential to confirm phenotype specificity, similar to approaches used for SP140 .

How does Tmem140 influence cellular signaling pathways in mouse models?

While specific mouse data is limited, research approaches should focus on:

  • Pathway analysis:

    • Gene Set Enrichment Analysis (GSEA) can identify associated pathways

    • Phosphoproteomic analysis to detect signaling changes

    • Transcriptomic profiling after Tmem140 modulation

  • Key pathways to investigate:

    • Apoptosis pathways (based on human studies showing regulation of Bcl2, Bax, and cleaved caspase3)

    • Cell adhesion molecule pathways (ICAM1, VCAM1, Syndecan1)

    • Cell cycle regulation pathways

  • Validation experiments:

    • Western blot analysis of key pathway proteins

    • Reporter gene assays for pathway activation

    • Co-immunoprecipitation to identify protein interaction partners

From human glioma studies, TMEM140 silencing significantly affects G0/G1 phase cell cycle progression (increasing cell population in this phase by 53.5% in U87 cells and 43.3% in U373 cells, p<0.001) .

What are the considerations for validating Tmem140 knockout or knockdown specificity?

To ensure experimental rigor when modulating Tmem140 expression:

  • Genomic validation:

    • PCR and sequencing to confirm targeted modifications

    • Analysis of potential off-target effects, especially if using CRISPR/Cas9

    • Consideration of gene paralogs that might be affected

  • Expression validation:

    • Quantitative RT-PCR to confirm mRNA reduction

    • Western blot analysis to verify protein depletion

    • Immunofluorescence to assess cellular localization changes

  • Functional validation:

    • Rescue experiments with wild-type Tmem140 expression

    • Dose-dependent effects with varying levels of knockdown

    • Comparison of multiple independent knockout/knockdown lines

  • Controls:

    • Non-targeting siRNA/shRNA controls

    • Wild-type littermates for in vivo studies

    • Analysis of related family members to ensure specific targeting

Drawing from SP140 research methodology, deep sequencing of potential off-target regions and RNA-seq analysis can help confirm the specificity of genetic modifications .

How can Tmem140 function in disease models be effectively investigated?

Based on human TMEM140 studies in glioma:

  • Cancer models:

    • Cell line panels representing different cancer types

    • Patient-derived xenografts for translational relevance

    • Genetic mouse models of cancer with Tmem140 modulation

  • Experimental design:

    • In vitro studies of cell viability, migration, invasion

    • In vivo tumorigenicity and tumor growth studies

    • Correlative studies of Tmem140 expression with histopathological features

  • Clinical correlation:

    • Analysis of Tmem140 expression in patient samples

    • Correlation with clinical parameters (tumor size, grade, survival)

    • Multivariate analysis to establish prognostic value

What technologies are emerging for studying Tmem140 protein interactions and structure?

Advanced methodologies for Tmem140 research include:

  • Protein interaction studies:

    • Proximity labeling (BioID, APEX) for membrane protein interactions

    • Co-immunoprecipitation with crosslinking for transient interactions

    • Yeast two-hybrid or mammalian two-hybrid systems

  • Structural biology approaches:

    • Cryo-electron microscopy for membrane protein structure

    • X-ray crystallography (challenging for membrane proteins)

    • NMR for dynamic studies of protein regions

  • Live-cell imaging:

    • FRET/BRET for protein-protein interactions

    • Super-resolution microscopy for detailed localization

    • Optogenetic tools for temporal control of protein function

  • Single-cell analysis:

    • Single-cell RNA-seq for expression heterogeneity

    • Mass cytometry for protein expression at single-cell level

    • Spatial transcriptomics for tissue context analysis

What are common challenges in working with recombinant mouse Tmem140?

Membrane proteins like Tmem140 present specific experimental challenges:

  • Expression difficulties:

    • Toxicity when overexpressed

    • Protein misfolding or aggregation

    • Inefficient membrane insertion

  • Detection issues:

    • Limited antibody availability and specificity

    • Low expression levels in certain tissues

    • Extraction difficulties from membrane fractions

  • Functional assessment:

    • Undefined physiological ligands or binding partners

    • Complex signaling networks with redundancy

    • Context-dependent functions across cell types

How should researchers interpret contradictory findings in Tmem140 studies?

When facing contradictory results:

  • Consider biological context:

    • Cell type-specific effects

    • Species differences in protein function

    • Developmental or physiological state variations

  • Evaluate methodology:

    • Different knockdown/knockout techniques may have varying specificity

    • Overexpression artifacts versus physiological relevance

    • Acute versus chronic effects of manipulation

  • Technical considerations:

    • Antibody specificity verification

    • Validation across multiple experimental systems

    • Dose-dependent effects that may explain contradictions

  • Statistical analysis:

    • Appropriate statistical tests for experimental design

    • Consideration of sample sizes and power

    • Biological versus statistical significance

What are promising areas for future mouse Tmem140 research?

Based on current knowledge gaps:

  • Physiological functions:

    • Tissue-specific conditional knockout studies

    • Developmental role assessment

    • Interaction with other membrane proteins

  • Disease relevance:

    • Beyond cancer: neurological, immunological, or metabolic connections

    • Potential as therapeutic target based on human disease correlations

    • Biomarker potential in mouse models of human disease

  • Regulatory mechanisms:

    • Transcriptional regulation

    • Post-translational modifications

    • Trafficking and turnover dynamics

  • Therapeutic applications:

    • Development of modulators (inhibitors or activators)

    • Delivery systems for Tmem140-targeting therapies

    • Combination approaches with existing therapies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.