Recombinant Mouse Tmem141 is typically produced in heterologous expression systems:
Expression Systems:
Purification: Affinity chromatography using tags (e.g., GST or Myc/DDK) .
Storage: Lyophilized or liquid forms stabilized in Tris/PBS buffers with glycerol .
While Tmem141 is poorly characterized compared to other TMEM proteins, emerging data suggest potential roles in:
Cell Signaling: Interactions with pathways involving TGF-β/Smad and NF-κB, inferred from human TMEM homologs .
Membrane Dynamics: Predicted involvement in multi-pass membrane protein assemblies .
Disease Associations:
Recombinant Mouse Tmem141 is widely used in:
Expression in Disease: Human TMEM141 overexpression correlates with poor prognosis in pancreatic cancer . Mouse models may provide insights into conserved mechanisms.
Technical Utility: The recombinant protein’s GST tag facilitates pull-down assays for binding partner identification .
Limitations: Species-specific functional data for mouse Tmem141 remain sparse, necessitating further studies .
Research priorities include elucidating Tmem141’s role in vivo, particularly its interaction with signaling cascades like TGF-β and NF-κB, and validating its potential as a therapeutic target in oncology . Comparative studies between mouse and human isoforms will clarify functional conservation.
Mouse Tmem141 is a small transmembrane protein consisting of 108 amino acids with a predicted molecular weight of 12.3 kDa. The full amino acid sequence is: MVNLGLSRVDDAVAARHPGLEEFAACQSHAFMKGVFTFVTGTGATFGLLMFIKRKFPYPVQWSFLVSAIAGSVASYRVTSMECQKCSNLWLFLETGQLPKDISTDPHD . The protein belongs to the larger family of transmembrane proteins and contains transmembrane domains that anchor it within cellular membranes. X-ray crystallography and structural prediction models suggest the protein adopts a characteristic conformation with membrane-spanning regions that facilitate its localization primarily to endocytic compartments within cells. When working with recombinant versions, researchers should note that commercially available constructs often include tags such as C-terminal MYC/DDK, which may influence protein behavior in certain experimental contexts .
Tmem141 demonstrates ubiquitous expression across mouse tissues, with particularly notable expression in the liver where it plays a role in cholesterol metabolism. In vitro studies have revealed that the protein primarily localizes to endocytic compartments within cells, suggesting its involvement in vesicular trafficking pathways . To accurately study its tissue distribution, researchers should employ multiple complementary techniques including qRT-PCR for mRNA quantification, Western blotting for protein detection, and immunohistochemistry for spatial localization within tissues. When analyzing expression patterns, special attention should be given to metabolic tissues like liver, adipose, and macrophages where Tmem141 has been linked to lipid metabolism functions. The expression pattern can be significantly altered under different physiological conditions, showing marked induction by Farnesoid X Receptor (FXR) agonists and repression in metabolic disease models such as db/db mice or those fed high-fat diets .
While mouse Tmem141 and human TMEM141 share considerable sequence homology and functional similarities, several key differences exist that researchers must consider when translating findings across species. The human TMEM141 protein sequence (MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS) shows subtle amino acid variations compared to the mouse ortholog . These variations primarily occur in the cytoplasmic domains rather than transmembrane regions, potentially affecting protein-protein interactions while preserving membrane topology. When conducting cross-species studies, researchers should perform rigorous sequence alignments and consider using both species' proteins in parallel experiments to validate functional conservation. Commercially available recombinant proteins differ in their expression systems, with human TMEM141 typically expressed in E. coli with an N-terminal GST tag, while mouse Tmem141 is often expressed in HEK293T cells with C-terminal MYC/DDK tags . These differences in expression systems and tags must be considered when interpreting experimental results.
When working with recombinant mouse Tmem141, researchers should store the protein at -80°C upon receipt and minimize freeze-thaw cycles to maintain activity . For cell culture applications, filtering through a 0.22 μm membrane is recommended, though some protein loss may occur during filtration . The optimal buffer system for functional studies is 25 mM Tris-HCl, 100 mM glycine, pH 7.3 with 10% glycerol, which maintains protein stability while allowing sufficient solubility . Typical working concentrations range from 0.1-1.0 μg/mL depending on the specific application, with higher concentrations required for protein-protein interaction studies. When designing experiments, researchers should include appropriate controls including empty vector-expressed proteins with identical tags to account for potential tag-mediated effects. For membrane protein reconstitution assays, gradual detergent removal via dialysis or adsorption methods produces the most consistent results with this transmembrane protein. All experiments should incorporate positive controls (proteins with known activity under the test conditions) to confirm assay functionality.
To study the established interaction between Tmem141 and ABCA1, several complementary approaches yield robust results. Co-immunoprecipitation assays have successfully demonstrated direct interaction between these proteins , with the following protocol modifications yielding optimal results: (1) use of mild detergents (0.5% NP-40 or 1% digitonin) to preserve membrane protein associations; (2) inclusion of protease inhibitor cocktails to prevent degradation; and (3) overnight incubation at 4°C to allow complete complex formation. For in situ visualization, proximity ligation assays (PLA) provide spatial resolution of interactions within cells, particularly in endocytic compartments. FRET/BRET approaches using tagged proteins can establish interaction dynamics in living cells. When expressing recombinant Tmem141 for interaction studies, researchers should consider the impact of the C-terminal MYC/DDK tag, potentially generating both tagged and untagged versions to confirm results . For quantitative binding assays, surface plasmon resonance using purified proteins can determine binding kinetics and affinity constants. Functional consequences of the interaction should be assessed through cholesterol efflux assays in both hepatocytes and macrophages, where Tmem141 deficiency has been shown to impair ABCA1-mediated cholesterol transport .
When designing loss-of-function studies for Tmem141, researchers have several effective methodologies available. For acute knockdown, adenoviral delivery of small hairpin RNA (shRNA) targeting Tmem141 (Ad-shTmem141) has demonstrated successful hepatic knockdown with pronounced phenotypic effects, including >8-fold decrease in total plasma cholesterol and >80% decrease in HDL-C and LDL-C . For experimental design, include appropriate controls such as adenovirus expressing LacZ (Ad-shLacZ) at matched viral titers, and monitor knockdown efficiency through both mRNA (qRT-PCR) and protein (Western blot) quantification . For cultured cells, siRNA transfection protocols should be optimized for each cell type (hepatocytes, macrophages, etc.) with attention to transfection efficiency and potential off-target effects. CRISPR/Cas9-mediated knockout provides more complete elimination of Tmem141 expression for longer-term studies, though potential compensatory mechanisms may emerge. Phenotypic assessment should include comprehensive lipoprotein profiling (HDL, LDL, VLDL) using both precipitation methods and FPLC separation for detailed analysis. Functional assessments should include measurements of ABCA1 expression and cholesterol efflux capacity in relevant cell types. For tissue-specific studies, researchers should consider AAV-mediated shRNA delivery with appropriate serotypes for targeting specific tissues.
Tmem141 functions as a novel posttranscriptional regulator of ABCA1 expression and cellular cholesterol homeostasis . Mechanistically, this regulation appears to operate primarily at the protein rather than transcriptional level. Evidence suggests Tmem141 influences ABCA1 degradation and recycling pathways, likely through its localization in endocytic compartments . To investigate this mechanism, researchers should employ pulse-chase experiments with metabolic labeling to track ABCA1 protein turnover rates in the presence and absence of Tmem141. Subcellular fractionation studies coupled with co-localization microscopy can map the trafficking pathways of both proteins. For protein degradation pathway analysis, selective inhibitors of lysosomal (bafilomycin A1, chloroquine) and proteasomal (MG132, bortezomib) degradation can determine which pathway predominates in Tmem141-mediated ABCA1 regulation. Cell surface biotinylation assays can quantify changes in plasma membrane ABCA1 levels when Tmem141 is manipulated. Mutagenesis of key domains within Tmem141 can identify specific regions necessary for ABCA1 interaction and stabilization. Researchers should also investigate potential roles in post-translational modifications of ABCA1, including ubiquitination, phosphorylation, and glycosylation patterns, which may be altered by Tmem141 and affect ABCA1 stability and function.
Given Tmem141's significant impact on cholesterol metabolism and ABCA1 regulation, its potential role in atherosclerosis development warrants thorough investigation. Researchers exploring this connection should design studies using atherosclerosis-prone mouse models (ApoE-/- or LDLR-/-) with targeted hepatic Tmem141 knockdown or overexpression . Comprehensive experimental designs should include: (1) time-course analysis of atherosclerotic lesion development using both en face aortic preparations and serial aortic root sections; (2) detailed plaque composition analysis examining macrophage content, necrotic core formation, and collagen deposition; (3) inflammatory biomarker profiling in plasma and within lesions; and (4) bone marrow transplantation studies to distinguish hepatic versus myeloid Tmem141 contributions to atherogenesis. Mechanistic studies should explore reverse cholesterol transport efficiency using radiolabeled cholesterol macrophage-to-feces assays in vivo. The dramatic effects of Tmem141 knockdown on plasma cholesterol levels (>8-fold decrease) and HDL-C (>80% decrease) suggest potentially profound impacts on atherosclerosis progression that may be either protective or detrimental depending on the balance between reduced atherosclerotic lipoprotein levels and impaired HDL-mediated cholesterol efflux . Cell-specific conditional knockout models would provide valuable insights into tissue-specific contributions.
The significant effects of Tmem141 on cholesterol metabolism position it as a potential therapeutic target for dyslipidemia and related metabolic disorders. For researchers exploring this avenue, several approaches merit investigation. Small molecule screening assays can identify compounds that modulate Tmem141-ABCA1 interactions, potentially enhancing ABCA1 stability and function. Such screens should employ cell-based assays measuring cholesterol efflux as a functional readout rather than simple binding assays. Structure-based drug design approaches, while challenging due to limited structural information on membrane proteins, can target specific domains identified through mutagenesis studies. For therapeutic development, researchers should establish dose-response relationships between Tmem141 expression levels and metabolic outcomes, determining whether partial modulation might achieve beneficial effects while avoiding adverse consequences of complete suppression. Liver-directed antisense oligonucleotides or siRNA delivery systems represent potential therapeutic modalities given the importance of hepatic Tmem141 . Pharmacodynamic markers should include plasma lipid profiles, ABCA1 protein levels in accessible cells (such as peripheral blood mononuclear cells), and functional cholesterol efflux capacity measurements. Safety assessments must evaluate potential unintended consequences on inflammation, immune function, and other metabolic pathways given the ubiquitous expression of Tmem141 across tissues.
Inconsistent results in Tmem141 expression studies often stem from several methodological challenges that can be systematically addressed. For detection issues, consider the following: (1) antibody selection is critical, as commercial antibodies vary in specificity – validate antibodies using positive controls (recombinant protein) and negative controls (knockdown samples); (2) optimize protein extraction protocols specifically for membrane proteins using buffer systems containing 1% NP-40 or 0.5% Triton X-100; and (3) employ enhanced chemiluminescence detection for Western blots due to potentially low expression levels . For mRNA quantification, design primers spanning exon-exon junctions to avoid genomic DNA amplification and validate PCR efficiency using standard curves. To address biological variability, standardize experimental conditions including feeding/fasting status of animals (as Tmem141 is metabolically regulated) and timing of tissue collection. For cell culture experiments, maintain consistent confluence levels and passage numbers, as these may affect expression. When comparing intervention groups, be aware that Tmem141 expression is dynamically regulated by metabolic conditions, showing repression in db/db mice and high-fat diet models but induction by FXR activation . Statistical analysis should account for these potential confounding variables through appropriate normalization to housekeeping genes/proteins and larger sample sizes to overcome inherent biological variability.
When analyzing Tmem141's effects on cholesterol metabolism, researchers should be vigilant for several common pitfalls. First, the dramatic effects observed with acute Tmem141 knockdown (>8-fold decrease in plasma cholesterol) may not translate to chronic depletion models due to compensatory mechanisms . To address this, employ both acute (adenoviral shRNA) and chronic (CRISPR knockout) models with appropriate time-course analyses. Second, interpreting phenotypes requires comprehensive lipoprotein profiling beyond total cholesterol measurements, as Tmem141 particularly affects HDL-C and LDL-C levels . Use multiple complementary methods including: (1) sequential ultracentrifugation; (2) fast protein liquid chromatography (FPLC); and (3) nuclear magnetic resonance spectroscopy for lipoprotein subclass analysis. Third, ABCA1 expression changes may appear discordant across different cell types (hepatocytes vs. macrophages) or at different levels (mRNA vs. protein); therefore, analyze both transcriptional and post-translational regulation in multiple relevant cell types . Fourth, cholesterol efflux assays are technically challenging and require standardization of cell cholesterol loading, acceptor concentrations, and incubation times. Finally, differentiate between direct Tmem141 effects and secondary consequences of altered lipid metabolism using appropriate controls, time-course experiments, and mechanistic validation studies including the established direct interaction between Tmem141 and ABCA1 through co-immunoprecipitation .
When confronted with contradictory findings between in vitro and in vivo Tmem141 studies, researchers should systematically evaluate several key factors that may explain these discrepancies. First, consider system complexity differences: in vivo studies capture the integrated response across multiple organs and feedback loops, whereas in vitro systems isolate specific cellular effects. For reconciliation, use primary cells freshly isolated from the same animal models used for in vivo studies rather than immortalized cell lines. Second, expression level differences between endogenous and overexpressed systems can significantly impact results—notably, hepatic overexpression of Tmem141 in mice yielded unchanged plasma cholesterol levels despite strong effects observed with knockdown . To address this, titrate expression levels in vitro to match physiological ranges and compare acute versus chronic manipulation timelines. Third, interacting protein availability may differ between systems; for example, the Tmem141-ABCA1 interaction demonstrated through co-immunoprecipitation may require additional co-factors present in vivo but absent in simplified in vitro systems . Fourth, evaluate model-specific limitations including potential compensatory mechanisms in knockout animals versus cell models. Finally, contextual regulation should be considered—Tmem141 function appears highly dependent on metabolic state, showing differential regulation in normal versus metabolically stressed conditions (db/db mice, high-fat diet) . A comprehensive analysis integrating tissue-specific conditional knockouts with matched in vitro studies using cells from the same genetic models can help resolve apparent contradictions.
Emerging technologies offer promising avenues to deepen our understanding of Tmem141 biology beyond current limitations. Cryo-electron microscopy applied to purified Tmem141-ABCA1 complexes could reveal structural interactions at near-atomic resolution, providing insights for structure-based drug design. Advanced proximity labeling techniques (BioID, APEX) applied to Tmem141 would identify the complete interactome beyond the established ABCA1 interaction, potentially uncovering additional regulatory partners and functional pathways . Single-cell technologies including scRNA-seq and spatial transcriptomics could reveal cell-specific expression patterns and responses to metabolic perturbations with unprecedented resolution. For dynamic trafficking studies, advanced live-cell imaging using lattice light-sheet microscopy with fluorescently tagged Tmem141 would allow real-time visualization of its movement through endocytic compartments. CRISPR interference/activation (CRISPRi/CRISPRa) systems permit tunable, reversible manipulation of Tmem141 expression, avoiding the binary nature of knockout/overexpression systems. Metabolomic profiling paired with Tmem141 manipulation would provide comprehensive insights into how this protein influences broader metabolic networks beyond cholesterol homeostasis. Finally, tissue-specific secretome analysis following Tmem141 manipulation could identify novel biomarkers associated with its activity that might serve as pharmacodynamic indicators for future therapeutic targeting.
Comparative studies of Tmem141 across species offer valuable insights for translational research by illuminating evolutionary conservation and divergence of function. Researchers should consider several strategic approaches. First, phylogenetic analysis of Tmem141 sequences from diverse vertebrates can identify highly conserved domains likely critical for function versus variable regions that may contribute to species-specific roles. The available European shrew (Sorex araneus) TMEM141 sequence information provides one such comparative resource . Second, functional studies in multiple model organisms (mice, rats, rabbits, non-human primates) can determine whether the dramatic effects of Tmem141 knockdown on cholesterol metabolism (>8-fold decrease in plasma cholesterol) are conserved across species with different lipoprotein profiles . Third, comparative expression profiling can reveal species-specific tissue distribution patterns and regulatory mechanisms. Fourth, creation of humanized mouse models expressing human TMEM141 on a mouse Tmem141-null background would directly assess functional conservation and translational relevance. Fifth, correlation studies between TMEM141 genetic variants and lipid profiles in human biobanks can establish clinical relevance. The available recombinant human TMEM141 protein (amino acid sequence: MVNLGLSRVDDAVAAKHPGLGEYAACQSHAFMKGVFTFVTGTGMAFGLQMFIQRKFPYPLQWSLLVAVVAGSVVSYGVTRVESEKCNNLWLFLETGQLPKDRSTDQRS) provides a valuable tool for such comparative functional studies . These multi-species approaches collectively strengthen the translational pipeline from basic discovery to potential therapeutic applications.
Advancing research on Tmem141 may yield several clinically relevant biomarkers for metabolic disorders and treatment monitoring. Based on its role in cholesterol metabolism and ABCA1 regulation, researchers should investigate several promising biomarker candidates . First, plasma Tmem141 protein levels may serve as indicators of metabolic status, given the protein's differential regulation in normal versus metabolically stressed conditions (repression in db/db mice and high-fat diet models) . Developing sensitive ELISA or mass spectrometry-based detection methods for circulating Tmem141 would be a priority for clinical translation. Second, the Tmem141-ABCA1 interaction strength in accessible cells (peripheral blood mononuclear cells) could predict cholesterol efflux capacity and atherosclerosis risk, measurable through proximity ligation assays or co-immunoprecipitation efficiency . Third, post-translational modification patterns of Tmem141 might reflect metabolic stress conditions. Fourth, downstream metabolite signatures resulting from altered Tmem141 activity could serve as functional readouts, detectable through targeted metabolomics. Fifth, tissue-specific expression patterns assessed through liquid biopsy approaches (circulating mRNA in exosomes) might inform on disease progression. For clinical application, researchers should establish reference ranges in healthy populations, validate prediction accuracy for disease outcomes in prospective cohorts, and determine responsiveness to therapeutic interventions. Integration with existing lipid biomarkers and genetic risk scores would enhance predictive power for personalized medicine applications.
Understanding how different expression systems affect recombinant mouse Tmem141 production is crucial for experimental design. The table below compares key parameters across expression systems:
When selecting an expression system, researchers should consider that HEK293T-expressed mouse Tmem141 with C-terminal MYC/DDK tags has been validated for functional studies, demonstrating proper folding and membrane insertion . For applications studying the Tmem141-ABCA1 interaction, mammalian expression systems are strongly recommended due to their superior ability to produce properly folded membrane proteins with correct post-translational modifications. The functional activity should be assessed through cholesterol efflux assays, as this represents the most physiologically relevant measure of proper Tmem141 function in regulating ABCA1 .
The differential effects of Tmem141 manipulation across mouse models provide important insights into its context-dependent functions: