Recombinant Mouse Transmembrane protein 14A (Tmem14a)

What is the molecular structure of mouse TMEM14A protein?

Mouse Transmembrane protein 14A (TMEM14A) is an integral membrane protein consisting of 99 amino acids with three distinct transmembrane domains. The full amino acid sequence is:

MDLIGFGYAALVTIGSVLGYKRRGGVPSLIAGLSVGLLAGYGAYRVSNDRRDVKVSLFTA FFLATIMGVRFKRSKKVMPAGLVAGLSLMMILRLVLLLL

The protein has a molecular weight that enables effective separation using standard SDS-PAGE techniques, with purified recombinant preparations typically showing greater than 90% purity . TMEM14A is primarily localized to the mitochondria, which is significant for understanding its functional role in cellular metabolism .

What are the known biological functions of TMEM14A?

TMEM14A serves several important biological functions:

• Protection of glomerular filtration barrier (GFB) integrity in the kidney

• Suppression of Bax-mediated apoptosis

• Regulation of energy metabolism, including glycolysis and oxygen respiration

• Potential role in cell cycle regulation and proliferation

Studies in spontaneously proteinuric rat models have shown that diminished TMEM14A expression precedes the onset of proteinuria. Knocking down tmem14a mRNA translation in zebrafish embryos results in proteinuria without affecting tubular reabsorption, demonstrating its critical role in maintaining GFB integrity .

How is TMEM14A expression regulated in normal vs. disease states?

TMEM14A expression shows distinct patterns in normal and pathological conditions:

• In normal tissues: TMEM14A is primarily expressed by podocytes in the kidney

• In kidney disease: Increased glomerular TMEM14A expression is observed in various proteinuric renal diseases, suggesting a compensatory protective mechanism

• In cancer: TMEM14A is highly expressed in ovarian cancer tumors and correlates with poor prognostic conditions

This differential expression pattern makes TMEM14A both a potential diagnostic and prognostic biomarker for conditions including proteinuric kidney diseases and ovarian cancer .

What are the optimal conditions for reconstitution and storage of recombinant mouse TMEM14A protein?

For optimal reconstitution and storage of recombinant mouse TMEM14A:

• Centrifuge the vial briefly before opening to collect contents at the bottom

• Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended)

• Aliquot for long-term storage at -20°C/-80°C

• Avoid repeated freeze-thaw cycles as they compromise protein stability

• For short-term use, working aliquots may be stored at 4°C for up to one week

The protein is typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which provides optimal stability during lyophilization and storage .

How can researchers effectively silence or overexpress TMEM14A in experimental models?

To manipulate TMEM14A expression levels, researchers have successfully employed several methods:

For TMEM14A silencing:

• RNA interference (RNAi) using siRNAs targeting specific regions of human TMEM14A (NM_014051)

  • Validated target sequences include:

    • siTMEM14A-1: TAGCACTGTCACCTCTAATAT

    • siTMEM14A-2: AAGCTTAAACTACAACTTGTC

    • siTMEM14A-3: AAGTGGAGTTCACAGAATGAT

For TMEM14A overexpression:

• Lentiviral-mediated vector transfection:

  • Seed cells (5×10^5 cells/well) in 12-well plates and culture to 80% confluence

  • Incubate in serum-free medium for 4 hours before transfection

  • Transfect with lentiviruses for 3 days

  • Filter transfected cells using a 0.45 μM mesh

  • Concentrate viral particles at 70,000 × g at 4°C for 2 hours

  • Collect supernatant for viral titer determination

  • Culture target cells with diluted lentiviruses and assess transfection rate after 72 hours

  • Verify transfection efficacy using RT-qPCR when lentivirus transfection rate exceeds 80%

These techniques have been validated in various cell lines, including ovarian cancer cell lines such as CAOV3 .

What assays are most effective for quantifying TMEM14A protein levels?

Several assays have proven effective for TMEM14A quantification:

• ELISA (Enzyme-Linked Immunosorbent Assay):

  • Commercial ELISA kits are available specifically for mouse TMEM14A quantification

  • These provide in vitro quantitative measurement of TMEM14A concentrations in various sample types

• Western Blotting:

  • SDS-PAGE separation followed by immunoblotting

  • Recommended for semi-quantitative analysis and size verification

  • Greater than 90% purity can be verified through this method

• qRT-PCR:

  • For mRNA expression level quantification

  • Useful for validating knockdown or overexpression efficiency

• Immunohistochemical staining:

  • Applied to determine expression patterns of TMEM14A in tissue samples

  • Has been used to examine TMEM14A expression in tumor tissues versus para-carcinoma tissues

How does TMEM14A affect cellular metabolism and mitochondrial function?

TMEM14A has significant effects on cellular energy metabolism:

• Glycolysis regulation:

  • TMEM14A knockdown suppresses glycolytic activity in cancer cells

  • This is evidenced by decreased extracellular acidification rates measured using the Seahorse XF24 analyzer

• Oxygen consumption:

  • TMEM14A promotes oxygen respiration

  • Its silencing results in reduced oxygen consumption rates in experimental models

• Mitochondrial localization:

  • TMEM14A localizes to mitochondria, suggesting a direct role in regulating mitochondrial function

  • This localization may explain its involvement in both apoptotic pathways and energy metabolism

These findings suggest that TMEM14A serves as a critical regulator of cellular bioenergetics, particularly in rapidly proliferating cells such as cancer cells.

What is the relationship between TMEM14A and apoptotic pathways?

The relationship between TMEM14A and apoptosis is multifaceted:

• Bax-mediated apoptosis:

  • TMEM14A has been implicated in suppressing Bax-mediated apoptosis

  • This anti-apoptotic activity may contribute to its oncogenic potential in certain cancers

• Cell survival mechanisms:

  • In ovarian cancer cells, TMEM14A inhibits apoptosis

  • Flow cytometric analysis has been used to demonstrate reduced apoptotic rates in cells overexpressing TMEM14A

• Correlation with c-Myc:

  • TMEM14A is positively correlated with c-Myc expression

  • Overexpression of c-Myc can rescue cellular functions in TMEM14A-depleted cells

  • This suggests a potential regulatory relationship between these two factors in controlling cell survival and metabolism

Understanding these mechanisms could provide insights into potential therapeutic approaches targeting TMEM14A in diseases characterized by dysregulated apoptosis.

How do TMEM14A expression patterns correlate with disease progression in kidney and cancer models?

TMEM14A expression exhibits distinct correlations with disease progression:

In kidney disease models:

• Expression is diminished before the onset of proteinuria in spontaneously proteinuric rat models

• Subsequent increased glomerular expression is observed in various proteinuric renal diseases, suggesting a compensatory protective mechanism

• Knockdown of tmem14a in zebrafish embryos directly results in proteinuria, confirming its critical role in maintaining glomerular filtration barrier integrity

In cancer models:

These findings highlight the context-dependent nature of TMEM14A function, serving as a protective factor in the kidney while potentially promoting disease progression in certain cancers.

What are the current limitations in TMEM14A research methodologies?

Several methodological challenges persist in TMEM14A research:

• Protein structure determination:

  • As a transmembrane protein, TMEM14A presents challenges for structural studies

  • Complete three-dimensional structure remains to be fully elucidated

  • This limits understanding of structure-function relationships

• Specificity of detection tools:

  • Available antibodies may have cross-reactivity issues with other TMEM family members

  • Validation of antibody specificity is crucial for accurate results

• In vivo models:

  • Limited availability of tissue-specific conditional knockout models

  • Current models may not fully recapitulate human disease conditions

  • Zebrafish models have provided some insights but mammalian models are needed for comprehensive understanding

• Mechanistic studies:

  • Complete signaling pathways involving TMEM14A remain incompletely characterized

  • Interaction partners beyond c-Myc require further investigation

Addressing these limitations will be essential for advancing TMEM14A research and developing potential therapeutic applications.

How can researchers resolve contradictory findings about TMEM14A function in different tissue contexts?

To address apparently contradictory findings regarding TMEM14A function:

• Context-dependent studies:

  • Design experiments that directly compare TMEM14A function across different cell types and tissues

  • Use identical methodologies and reagents to minimize technical variability

• Post-translational modification analysis:

  • Investigate whether TMEM14A undergoes tissue-specific post-translational modifications

  • These modifications could explain functional differences in various contexts

• Interaction partner mapping:

  • Conduct comprehensive interactome studies to identify tissue-specific binding partners

  • Different interaction networks could explain diverse functional outcomes

• Isoform-specific analysis:

  • Determine whether different TMEM14A isoforms are expressed in various tissues

  • Characterize the functional differences between potential isoforms

• Integrated multi-omics approach:

  • Combine transcriptomics, proteomics, and metabolomics data

  • This integrated approach can reveal tissue-specific regulatory networks controlling TMEM14A function and effects

These strategies can help reconcile seemingly contradictory findings, such as TMEM14A's protective role in kidney tissue versus its potential oncogenic function in cancer contexts.

What are promising therapeutic applications targeting TMEM14A in disease models?

Emerging research suggests several promising therapeutic directions:

• Kidney disease applications:

  • TMEM14A upregulation or stabilization could potentially preserve glomerular filtration barrier integrity

  • This approach might be beneficial in proteinuric kidney diseases resistant to current therapies

  • Delivery methods to specifically target podocytes will be crucial for this application

• Cancer treatment strategies:

  • TMEM14A inhibition represents a potential therapeutic approach for ovarian cancer and potentially other malignancies

  • As TMEM14A inhibits apoptosis and promotes cellular metabolism, its targeting could sensitize cancer cells to existing treatments

  • Combined approaches targeting both TMEM14A and c-Myc pathways may yield synergistic effects

• Biomarker applications:

  • TMEM14A expression patterns could serve as diagnostic and prognostic biomarkers

  • In ovarian cancer, TMEM14A has been recognized as both a diagnostic and prognostic biomarker candidate

  • Similar applications might extend to kidney diseases and other cancers where TMEM14A plays a role

These therapeutic directions require further validation in preclinical models before clinical translation, but they represent promising avenues for addressing diseases with limited current treatment options.

What are the critical factors for successful recombinant TMEM14A protein production?

For optimal recombinant TMEM14A production:

• Expression system selection:

  • E. coli systems have been successfully used for mouse TMEM14A expression

  • Fusion with an N-terminal His tag facilitates purification without compromising function

  • For applications requiring post-translational modifications, mammalian expression systems may be preferable

• Purification strategy:

  • Affinity chromatography using His-tag is effective

  • Purification should achieve >90% purity as determined by SDS-PAGE

• Quality control measures:

  • Verify protein identity through mass spectrometry

  • Confirm proper folding through circular dichroism or functional assays

  • Assess batch-to-batch consistency with standardized quality control protocols

• Storage considerations:

  • Lyophilized powder form provides extended stability

  • Storage buffer optimization with 6% Trehalose at pH 8.0 enhances stability

  • Glycerol addition (5-50%) for reconstituted protein prevents freeze-thaw damage

These technical considerations are essential for producing consistent, high-quality recombinant TMEM14A for experimental applications.

How can researchers effectively design experiments to study TMEM14A function in complex disease models?

Robust experimental design for studying TMEM14A in disease models should include:

• Model selection:

  • For kidney research: Consider spontaneously proteinuric rat models or zebrafish embryo models with tmem14a knockdown

  • For cancer research: Use xenograft mice models with TMEM14A silencing or overexpression

• Temporal considerations:

  • Design time-course experiments to capture dynamic changes in TMEM14A expression

  • This is particularly important as TMEM14A expression changes precede disease manifestations in kidney models

• Combined approaches:

  • Integrate in vitro, ex vivo, and in vivo methodologies

  • For example, combine cell culture experiments with patient-derived samples and animal models

• Control selection:

  • Include both positive and negative controls

  • For silencing experiments, use multiple siRNA sequences to confirm specificity of effects

  • Consider rescue experiments by reintroducing TMEM14A to confirm phenotype reversibility

• Endpoint measurements:

  • For kidney studies: Measure proteinuria, podocyte morphology, and glomerular filtration rate

  • For cancer studies: Assess cell proliferation using CCK-8 assay, apoptosis via flow cytometry, and metabolic parameters using Seahorse XF24 analyzer

These design principles enhance experimental rigor and facilitate meaningful interpretation of results across different disease contexts.

What are the most sensitive methods for detecting changes in TMEM14A expression in tissue samples?

For optimal detection of TMEM14A expression changes:

• RNA-level detection:

  • RT-qPCR offers high sensitivity for mRNA quantification

  • Primer design should ensure specificity for TMEM14A

  • RNAscope or similar in situ hybridization techniques allow visualization of mRNA in tissue context

• Protein-level detection:

  • Immunohistochemistry for spatial distribution in tissues

  • Western blotting for semi-quantitative analysis

  • ELISA for precise quantification of protein levels

  • Mass spectrometry for absolute quantification and post-translational modification analysis

• Single-cell approaches:

  • Single-cell RNA sequencing for heterogeneity assessment

  • CyTOF or spectral flow cytometry for protein-level analysis at single-cell resolution

• Comparative analysis:

  • Always include appropriate controls (normal adjacent tissue, tissue from healthy individuals)

  • Use standardized protocols to minimize technical variability

  • Consider both absolute levels and relative changes in expression

These methods can be applied to both clinical specimens and experimental models, enabling sensitive detection of TMEM14A expression changes in various research contexts.

What are the most significant recent advances in TMEM14A research?

Recent significant advances in TMEM14A research include:

• Functional characterization in kidney disease:

  • Identification of TMEM14A as a critical protein for maintaining glomerular filtration barrier integrity

  • Demonstration that its expression is diminished before proteinuria onset in rat models

  • Confirmation of its role through zebrafish embryo knockdown studies

• Cancer biology insights:

  • Discovery of TMEM14A overexpression in ovarian cancer tissues

  • Elucidation of its role in inhibiting apoptosis and promoting energy metabolism

  • Identification of its positive correlation with c-Myc and potential prognostic value

• Methodological developments:

  • Establishment of reliable protocols for TMEM14A silencing and overexpression

  • Development of specific detection methods including ELISA kits for mouse TMEM14A

  • Validation of experimental models for studying TMEM14A function

These advances have significantly expanded our understanding of TMEM14A biology and its potential relevance to human disease.

What research questions about TMEM14A remain unanswered?

Despite recent progress, several important questions about TMEM14A remain unanswered:

• Structural biology:

  • What is the detailed three-dimensional structure of TMEM14A?

  • How does this structure relate to its various functions?

• Regulatory mechanisms:

  • What factors control TMEM14A expression in different tissues?

  • How is TMEM14A expression dysregulated in disease states?

• Signaling pathways:

  • What are the complete upstream and downstream signaling pathways involving TMEM14A?

  • How does TMEM14A interact with other mitochondrial proteins?

• Tissue-specific functions:

  • Why does TMEM14A appear protective in kidney tissue but potentially oncogenic in cancer contexts?

  • Are there tissue-specific interacting partners that modify its function?

• Therapeutic potential:

  • Can TMEM14A be effectively targeted for therapeutic intervention?

  • What strategies might specifically modulate its function in diseased tissues while sparing normal function?

Addressing these questions will require interdisciplinary approaches and could significantly advance both basic science understanding and therapeutic applications.

How might emerging technologies advance TMEM14A research in the next decade?

Emerging technologies poised to advance TMEM14A research include:

• Cryo-electron microscopy:

  • Will enable high-resolution structural analysis of TMEM14A within membranes

  • May reveal conformational changes associated with different functional states

• CRISPR-based technologies:

  • CRISPR/Cas9 for precise genome editing to create improved disease models

  • CRISPRa/CRISPRi for targeted modulation of TMEM14A expression

  • Base editing for introducing specific mutations to study structure-function relationships

• Spatial transcriptomics and proteomics:

  • Will provide insights into tissue-specific expression patterns with unprecedented resolution

  • Can reveal microenvironmental factors influencing TMEM14A function

• Organoid and microphysiological systems:

  • Patient-derived organoids for personalized disease modeling

  • Kidney-on-a-chip and tumor-on-a-chip platforms for controlled studies of TMEM14A in complex tissue contexts

• AI and computational biology:

  • Machine learning approaches for predicting TMEM14A interactions and functions

  • Systems biology modeling of TMEM14A in cellular networks

  • Virtual screening for potential TMEM14A modulators