Recombinant Mouse Transmembrane protein 14C (Tmem14c)

Shipped with Ice Packs
In Stock

Description

General Information

Transmembrane protein 14C (Tmem14c) is a protein-coding gene in mice . It is also found in humans . TMEM14C is associated with diseases such as sideroblastic anemia and trachea adenoid cystic carcinoma .

Aliases for TMEM14C Gene :

  • C6orf53

External IDs for TMEM14C Gene :

  • HGNC: 20952

  • NCBI Gene: 51522

  • Ensembl: ENSG00000111843

  • OMIM®: 615318

  • UniProtKB/Swiss-Prot: Q9P0S9

Function and Characteristics

TMEM14C is predicted to be involved in mitochondrial transport and is located in the mitochondrial inner membrane . It is also predicted to act upstream in erythrocyte differentiation and in the regulation of the heme biosynthetic process . TMEM14C is required for normal heme biosynthesis .

Expression

High levels of CXCL14 transcripts are constitutively expressed in the basal layer of epidermal keratinocytes and dermal fibroblasts of skin tissues, as well as lamina propria cells in normal intestinal tissues . Macrophages frequently co-localize with CXCL14-producing cells in the dermis and lamina propria, which is consistent with the hypothesis that CXCL14 regulates macrophage precursor trafficking to regions in the skin and mucosal tissues to support their development .

Recombinant Mouse Tmem14c Availability

Recombinant Mouse Transmembrane protein 14C (Tmem14c) is available for purchase from various sources . The protein can be produced in different expression systems, including yeast, E. coli, baculovirus, and mammalian cells .

Table: Recombinant Mouse Tmem14c Products

CodeSourceConjugate
CSB-YP023722MO1YeastN/A
CSB-EP023722MO1E. coliN/A
CSB-EP023722MO1-BE. coliAvi-tag Biotinylated E. coli biotin ligase (BirA). Biotinylation occurs in vivo via AviTag-BirA technology, where BriA catalyzes amide linkage between biotin and a specific lysine of the AviTag.
CSB-BP023722MO1BaculovirusN/A
CSB-MP023722MO1Mammalian cellN/A

Related Research

  • CXCL14 and Macrophage Polarization: CXCL14 regulates macrophage polarization via perivascular adipocytes, which can ameliorate atherosclerosis .

  • G-CSF and Neutropenia: Mutations in the G-CSF receptor can lead to maturation arrest of neutrophilic precursors in the bone marrow and neutropenia in peripheral blood .

  • IFITM5 Gene Mutation: A mutation (c.-14C>T) in the IFITM5 gene is responsible for autosomal dominant Osteogenesis Imperfecta (OI) type V .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem14c; Transmembrane protein 14C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-114
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem14c
Target Protein Sequence
QKDSGPLMPLHYFGFGYAALVATGGIIGYAKAGSVPSLAAGLFFGGLAGLGAYQLSQDPR NVWVFLATSGTLAGIMGMRFYNSGKFMPAGLIAGASLLMVAKVGISLLSSPHP
Uniprot No.

Target Background

Function
Essential for normal heme biosynthesis.
Gene References Into Functions
  1. TMEM14C facilitates the import of protoporphyrinogen IX into the mitochondrial matrix for heme synthesis and subsequent hemoglobin production. PMID: 25157825
Database Links

KEGG: mmu:66154

UniGene: Mm.30005

Protein Families
TMEM14 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is TMEM14C and what role does it play in cellular metabolism?

TMEM14C is a multi-pass transmembrane protein that plays an essential role in erythroid mitochondrial heme metabolism. Research demonstrates that TMEM14C facilitates the import of protoporphyrinogen IX into the mitochondrial matrix for heme synthesis and subsequent hemoglobin production . In TMEM14C-deficient cells, protoporphyrin IX synthesis is blocked, leading to an accumulation of porphyrin precursors. The heme synthesis defect in TMEM14C-deficient cells can be ameliorated with a protoporphyrin IX analog, indicating that TMEM14C primarily functions in the terminal steps of the heme synthesis pathway .

  • Where is TMEM14C primarily expressed in organisms?

TMEM14C is enriched in vertebrate hematopoietic tissues . Gene expression profiling of terminally differentiating murine fetal liver-derived erythroid cells shows that TMEM14C is upregulated during erythroid terminal differentiation . This expression pattern aligns with its role in heme synthesis, as maturing erythroid cells synthesize large amounts of heme to keep pace with the high rate of hemoglobin synthesis .

  • What is the subcellular localization of TMEM14C?

TMEM14C is predominantly localized to the inner mitochondrial membrane. This localization has been confirmed through subcellular fractionation experiments and colocalization studies with mitochondrial markers. Specifically, hypotonic swelling experiments with isolated mitochondria showed that TMEM14C is not an intermembrane space protein, and trypsin treatment experiments demonstrated it is not an outer membrane protein . Its inner-mitochondrial localization is consistent with its role in facilitating the transport of mitochondrial porphyrins in developing erythroid cells .

  • What research models are available for studying TMEM14C function?

Several research models have been developed to study TMEM14C function:

Model TypeDescriptionApplicationReference
Gene-trap mouse embryonic stem cellsTmem14c^gt/gt embryos are severely anemic and die by E13.5In vivo studies of TMEM14C in development
CRISPR/Cas-edited MEL cellsStable compound heterozygote knockout cellsCell culture studies of TMEM14C function
shRNA-silenced MEL cellsStable knockdown of Tmem14c expressionCell culture studies of TMEM14C function
Recombinant proteinBaculovirus-expressed partial mouse TMEM14CProtein interaction studies, antibody validation
Primary murine fetal liver cellsEx vivo culture systemStudying TMEM14C in primary erythroid cells
  • How should recombinant mouse TMEM14C be stored and handled?

According to product specifications, recombinant mouse TMEM14C has specific storage and handling requirements :

  • The shelf life of liquid form is approximately 6 months at -20°C/-80°C

  • The shelf life of lyophilized form is approximately 12 months at -20°C/-80°C

  • Repeated freezing and thawing should be avoided

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstitution, briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

  • What is the purity and source of commercially available recombinant mouse TMEM14C?

Commercial recombinant mouse TMEM14C preparations typically have a purity of >85% as assessed by SDS-PAGE . The recombinant protein is commonly produced using baculovirus expression systems, which allow for proper folding and post-translational modifications. The immunogen species is Mus musculus (Mouse), and the protein length is often described as "partial," indicating that it may not represent the full-length protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.