Recombinant Mouse Transmembrane protein 150A (Tmem150a)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Tmem150a

Recombinant Mouse Tmem150a is a full-length or partial protein (amino acids 25–271) expressed in heterologous systems such as E. coli or mammalian cells. It is fused with affinity tags (e.g., His, Fc-Avi) for purification and detection . The protein is derived from the Tmem150a gene (UniProt ID: Q91WN2), which encodes a 271-amino-acid transmembrane protein involved in phosphatidylinositol 4,5-bisphosphate [PI(4,5)P₂] regulation and TLR4-mediated cytokine signaling .

Role in Innate Immune Signaling

Knockdown studies in TLR4-expressing epithelial cells revealed that TMEM150A modulates cytokine production:

  • TLR4 Activation: TMEM150A-deficient cells showed elevated LPS-induced CXCL8, IL6, and CCL5 secretion (2–3 fold increase vs. controls) .

  • Transcript Regulation: qPCR confirmed upregulated CXCL8, IL6, and TNF mRNA levels post-LPS stimulation in TMEM150A knockdown cells .

  • Homeostatic Role: Basal cytokine levels increased in unstimulated TMEM150A-deficient lung epithelial cells (H292 line), suggesting a regulatory role in cellular homeostasis .

Mechanism of Action

TMEM150A interacts with phosphatidylinositol 4-kinase (PI4KIIIα) to regulate PI(4,5)P₂ distribution at plasma membranes. Altered PI(4,5)P₂ levels disrupt TLR4 signaling, implicating TMEM150A in lipid-mediated immune pathway modulation .

Expression Systems

SystemAdvantagesExample Products
E. coliCost-effective, high yieldRFL29991MF (Creative BioMart)
HEK293Post-translational modificationsTMEM150A-9306M (Fc-Avi-His tagged)
Cell-free synthesisRapid production, customizableABIN3127383 (Strep Tag, 70–80% purity)

Research Applications

  • Immunoassays: Used as a standard in ELISA and Western blotting with anti-TMEM150A antibodies (e.g., PA5-53892) .

  • Functional Studies: Investigates PI(4,5)P₂ dynamics, autophagy, and cytokine regulation .

  • Structural Biology: Strep Tag-labeled variants enable protein-protein interaction studies .

Comparative Analysis of Orthologs

Mouse TMEM150A shares 91% sequence identity with human and rat orthologs, making it a model for translational studies . Key differences include:

SpeciesUniProt IDKey Functional Domains
MouseQ91WN2Cytoplasmic N/C-termini, six transmembrane domains
HumanQ86TG189% homology to mouse, similar lipid-binding regions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem150a; Tmem150; Transmembrane protein 150A; Transmembrane protein 150
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-271
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem150a
Target Protein Sequence
MAVMNRHVCPVENWSYNESCSPDPAEQGGPKSCCTLDDVPLISKCGTYPPESCLFSLIGN MGAVMVALICLLRYGQLLEQSRHSWINTTALITGCTNAAGLVVVGNFQVDHAKSLHYIGT GVAFTAGLLFVCLHCVLFYHGATTPLDMAMAYLRSVLAVIAFITLVLSGVFFLHESSQLQ HGAALCEWVFVLDILIFYGTFSYEFGTISSDTLVAALQPAPGRACKSSGSSSTSTHLNCA PESIAMI
Uniprot No.

Target Background

Function
Tmem150a regulates the localization of phosphatidylinositol 4-kinase (PI4K) to the plasma membrane. It potentially achieves this by reducing the association of TTC7 (TTC7A or TTC7B) with the PI4K complex. It acts as a regulator of phosphatidylinositol 4-phosphate (PtdIns(4)P) synthesis. Additionally, Tmem150a may play a role in fasting-induced catabolism.
Database Links
Protein Families
DRAM/TMEM150 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic biological function of TMEM150A?

TMEM150A (Transmembrane Protein 150A), also known as TM6P1 or damage-regulated autophagy modulator 5, primarily functions as a regulator of phosphoinositide production at the plasma membrane. It modifies the composition of the phosphatidylinositol 4-kinase enzyme complex, thereby regulating PI(4,5)P₂ production, which is crucial for various cellular processes including autophagy. TMEM150A transcript levels increase in the liver under fasting conditions, which are known to induce autophagy, suggesting its role in cellular stress responses . The protein plays an important role in maintaining cellular homeostasis, particularly in regulating cytokine production in both stimulated and unstimulated conditions .

How is TMEM150A expression regulated in different tissues?

TMEM150A expression patterns vary across different tissues, with significant expression observed in immune cells and epithelial cells. In normal physiological conditions, TMEM150A maintains baseline expression, but this can change during cellular stress or immune activation. Studies have shown that TMEM150A transcript levels increase during fasting conditions in the liver . In contrast, its expression is dysregulated in certain pathological conditions, as evidenced by its overexpression in glioblastoma multiforme (GBM) tissues compared to normal tissues . The regulation of TMEM150A appears to be tissue-specific and responsive to environmental cues such as nutrient availability and immune stimulation.

What methods are commonly used to study TMEM150A knockdown effects?

To investigate TMEM150A function through knockdown studies, researchers typically employ RNA interference techniques:

  • siRNA Transfection: Specific siRNAs targeting TMEM150A (such as siRNA "A," "B," and "C" as mentioned in the literature) can be transfected into cultured cells using transfection reagents like Lipofectamine RNAiMax . The timing of transfection may vary depending on the cell type - for instance, HEK-TLR4 cells were transfected after the cells were adherent post-plating (approximately 18 hours), while H292 cells were transfected concurrent with plating .

  • Validation of Knockdown: The efficacy of TMEM150A knockdown should be validated using reverse transcriptase-quantitative polymerase chain reaction (RT-qPCR) analyses to measure transcript levels before proceeding with functional assays .

  • Functional Assays: Following knockdown validation, various functional assays can be performed to assess the impact on cellular processes, including cytokine production measurement (by ELISA or cytometric bead array), cellular proliferation assays, and signaling pathway analysis .

What are the recommended cell models for studying TMEM150A function?

Several cell models have proven effective for TMEM150A research, each with specific advantages:

  • HEK-TLR4 Cells: Engineered human embryonic kidney cells expressing Toll-like receptor 4 provide a clean system for studying TMEM150A's role in TLR4 signaling without the complexity of multiple signaling pathways present in immune cells .

  • H292 Lung Epithelial Cells: These cells model barrier-type epithelium at the interface of interstitium, vasculature, and external environment. They are more endogenously equipped to respond to immune stimuli compared to HEK cells and secrete various cytokines including CXCL8, CCL5, and IL6 . This makes them valuable for studying TMEM150A's role in cytokine regulation in a physiologically relevant context.

  • Glioblastoma Cell Lines: For cancer-related studies, GBM cell lines have been used to investigate the effects of TMEM150A on tumor cell proliferation, migration, and invasion through assays such as Cell Counting Kit-8, Wound healing, and Transwell experiments .

The choice of cell model should align with the specific research question being addressed.

How does TMEM150A interact with the phosphatidylinositol 4-kinase enzyme complex to regulate PI(4,5)P₂ production?

TMEM150A regulates PI(4,5)P₂ production through its interaction with the phosphatidylinositol 4-kinase (PI4KIIIα) complex. This interaction appears to modify the composition and/or activity of the kinase complex, thereby influencing the phosphorylation cascade that leads to PI(4,5)P₂ synthesis.

The mechanism involves:

  • Complex Formation: TMEM150A associates with PI4KIIIα at the plasma membrane, potentially serving as a scaffold or regulatory subunit.

  • Enzymatic Regulation: This association alters the kinetic properties or substrate specificity of PI4KIIIα, thereby affecting the rate of phosphatidylinositol 4-phosphate (PI4P) production, which is a precursor for PI(4,5)P₂.

  • Signaling Impact: The resulting changes in PI(4,5)P₂ levels affect downstream signaling pathways, including those involved in TLR4 signaling, where PI(4,5)P₂ derivatives (diacylglycerol and inositol trisphosphate) serve as second messengers .

Understanding this interaction is crucial as PI(4,5)P₂ is a key plasma membrane lipid mediator in multiple cellular processes, including immune signaling, cytoskeletal organization, and vesicular trafficking.

What are the molecular mechanisms by which TMEM150A regulates cytokine production in TLR4 signaling?

TMEM150A regulates cytokine production in TLR4 signaling through several interconnected molecular mechanisms:

  • Regulation of PI(4,5)P₂ Levels: TMEM150A modulates PI(4,5)P₂ production, which is critical for TLR4 signaling. LPS-induced signaling through TLR4 is mediated by PI(4,5)P₂ and its derivatives diacylglycerol and inositol trisphosphate .

  • Transcriptional Regulation: Knockdown studies revealed that TMEM150A deficiency leads to increased transcript levels of multiple cytokines (CCL5, IL6, CXCL8, and TNF) in both basal and LPS-stimulated conditions . This suggests that TMEM150A acts at or upstream of cytokine transcription, potentially influencing transcription factor activity or chromatin accessibility.

  • Cell-Type Specific Effects: The regulatory impact of TMEM150A appears to be cell-type dependent. In H292 lung epithelial cells, TMEM150A knockdown increased cytokine production even without TLR4 stimulation, indicating a broader role in maintaining cytokine homeostasis beyond TLR4-specific responses .

  • Dose-Dependent Response Modulation: Interestingly, the impact of TMEM150A deficiency on cytokine production varied with LPS concentration. The most pronounced effects were observed at no or low (30 ng/mL) LPS stimulation compared to higher doses (100 ng/mL) , suggesting a role in fine-tuning the threshold and amplitude of immune responses.

What experimental approaches can be used to study the role of TMEM150A in autophagy regulation?

To investigate TMEM150A's role in autophagy, researchers can employ the following methodological approaches:

  • Autophagosome Formation Assays:

    • LC3 Conversion: Monitor LC3-I to LC3-II conversion by western blotting in TMEM150A-knockdown or overexpressing cells.

    • Fluorescence Microscopy: Utilize GFP-LC3 puncta formation assays to visualize autophagosome formation.

    • Transmission Electron Microscopy: Directly observe autophagosome structures at ultrastructural level.

  • Autophagic Flux Measurement:

    • Lysosomal Inhibition: Combine TMEM150A manipulation with lysosomal inhibitors (e.g., bafilomycin A1, chloroquine) to assess autophagic flux.

    • Tandem Fluorescent-Tagged LC3: Use mRFP-GFP-LC3 constructs to distinguish between autophagosomes and autolysosomes.

  • PI(4,5)P₂ Dynamics Analysis:

    • PI(4,5)P₂ Biosensors: Employ fluorescent PI(4,5)P₂ biosensors to monitor real-time changes in PI(4,5)P₂ levels and distribution.

    • Phosphoinositide Analysis: Quantify phosphoinositide species using biochemical approaches such as thin-layer chromatography or mass spectrometry.

  • Autophagy Induction Conditions:

    • Nutrient Starvation: Compare autophagy responses between wild-type and TMEM150A-modified cells under starvation conditions.

    • TLR4 Stimulation: Assess whether TLR4 activation by LPS differentially affects autophagy in TMEM150A-deficient versus control cells .

  • Interaction Studies:

    • Co-immunoprecipitation: Identify protein-protein interactions between TMEM150A and autophagy machinery components.

    • Proximity Ligation Assays: Detect in situ interactions between TMEM150A and autophagy-related proteins.

These approaches should be combined with appropriate controls and validated in multiple cell types to comprehensively understand TMEM150A's role in autophagy regulation.

How can researchers effectively study the dual role of TMEM150A in both immune signaling and autophagy pathways?

Investigating the interconnected roles of TMEM150A in immune signaling and autophagy requires integrated experimental approaches:

  • Sequential and Parallel Pathway Analysis:

    • Implement time-course experiments following TMEM150A manipulation to determine temporal relationships between immune signaling events and autophagy induction.

    • Use pathway-specific inhibitors to dissect which aspects of TMEM150A function are dependent or independent of each pathway.

  • Domain-Specific Mutants:

    • Generate TMEM150A constructs with mutations in specific functional domains to identify regions responsible for immune signaling versus autophagy regulation.

    • Perform rescue experiments with these mutants in TMEM150A-knockdown cells to establish domain-specific functions.

  • Systems Biology Approaches:

    • Employ transcriptomics, proteomics, and phosphoproteomics to capture global cellular changes following TMEM150A manipulation.

    • Use computational modeling to integrate these multi-omics datasets and predict pathway crosstalk mechanisms.

  • Physiological Context Variation:

    • Compare TMEM150A functions under different physiological stresses (nutrient limitation, pathogen exposure, inflammatory cytokines).

    • Assess how TMEM150A coordinates autophagy and immune responses in different cell types relevant to immune function.

  • CRISPR-Based Screening:

    • Perform genetic screens to identify synthetic lethal or synthetic rescue interactions with TMEM150A in the context of immune or autophagy pathways.

    • Use CRISPR activation/inhibition libraries targeting immune or autophagy genes to find modifiers of TMEM150A function.

This multi-faceted approach allows researchers to delineate how TMEM150A serves as a potential integration point between cellular stress responses (autophagy) and immune signaling pathways.

What is the relationship between TMEM150A expression and disease progression in glioblastoma multiforme?

TMEM150A expression shows significant correlation with glioblastoma multiforme (GBM) progression and patient outcomes:

  • Expression Pattern Analysis:

    • TMEM150A is overexpressed in cancerous tissues of GBM patients compared to normal tissues, with an impressive area under the curve (AUC) value of 0.95 in receiver operating characteristic analysis, indicating strong diagnostic potential .

    • This overexpression pattern was validated across multiple datasets, demonstrating consistency in TMEM150A's association with GBM.

  • Prognostic Significance:

    • High TMEM150A expression correlates with poor prognostic indicators in GBM patients .

    • Multivariate analysis revealed that TMEM150A overexpression, along with isocitrate dehydrogenase (IDH) mutation status, independently predicts poor survival time among GBM patients .

  • Functional Impact on Tumor Biology:

    • In vitro experiments demonstrated that suppressing TMEM150A expression inhibits GBM cell proliferation, migration, and invasion capabilities .

    • These findings suggest that TMEM150A actively contributes to the aggressive phenotype of GBM cells rather than being merely a correlative marker.

  • Immune Microenvironment Association:

    • TMEM150A overexpression shows association with stromal, immune, and estimate scores in the tumor microenvironment .

    • Specific correlations were observed with immune cell populations including T helper 17 (Th17) cells, Th2 cells, and regulatory T cells, suggesting potential roles in immune evasion mechanisms .

  • RNA Modification Correlation:

    • TMEM150A expression correlates with RNA modifications in GBM, which may contribute to post-transcriptional regulation mechanisms in tumor progression .

These findings collectively position TMEM150A as not only a potential biomarker for GBM but also as a functional contributor to disease progression and a possible therapeutic target.

What are the optimal conditions for producing and purifying recombinant mouse TMEM150A protein?

For the efficient production and purification of recombinant mouse TMEM150A protein, researchers should consider the following methodological approach:

  • Expression System Selection:

    • Mammalian Expression Systems: Given that TMEM150A is a multi-pass transmembrane protein with potential post-translational modifications, mammalian expression systems (HEK293 or CHO cells) are often preferred for proper folding and modification.

    • Insect Cell Systems: Baculovirus-infected insect cells can also provide a good compromise between yield and post-translational modifications.

  • Construct Design:

    • Fusion Tags: Include purification tags (His6, FLAG, or Strep-tag II) at either N- or C-terminus, avoiding disruption of the transmembrane domains.

    • Truncation Constructs: Consider expressing the extracellular domain alone if the full-length protein proves challenging.

    • Codon Optimization: Optimize codons for the chosen expression system to enhance translation efficiency.

  • Solubilization and Purification:

    • Detergent Selection: Test multiple detergents (DDM, LMNG, digitonin) for efficient solubilization while maintaining protein structure and function.

    • Purification Strategy: Implement a two-step purification approach:

      • Initial capture by affinity chromatography (IMAC for His-tagged constructs)

      • Secondary purification by size exclusion chromatography to remove aggregates and ensure homogeneity

  • Quality Control Assessment:

    • Purity Analysis: SDS-PAGE with Coomassie staining and western blotting

    • Structural Integrity: Circular dichroism spectroscopy

    • Functional Validation: Binding assays with known interaction partners (e.g., components of the PI4KIIIα complex)

  • Storage Conditions:

    • Buffer Optimization: Typically, phosphate-buffered saline with appropriate detergent above its critical micelle concentration

    • Stabilizing Additives: Glycerol (10-20%) or specific lipids may enhance stability

    • Storage Temperature: Determine optimal temperature (-80°C, -20°C, or 4°C) through stability studies

This systematic approach should yield recombinant mouse TMEM150A suitable for structural and functional studies.

What are the key considerations for designing and validating TMEM150A knockout mouse models?

Creating and validating TMEM150A knockout mouse models requires careful consideration of several key factors:

  • Targeting Strategy Design:

    • Complete vs. Conditional Knockout: Assess whether complete deletion might result in embryonic lethality; consider conditional knockout using Cre-loxP or similar systems.

    • Exon Selection: Target exons that encode critical functional domains and/or create frameshift mutations to ensure functional disruption.

    • Off-Target Effects: Perform thorough in silico analysis to minimize potential off-target modifications.

  • Genotyping and Verification:

    • PCR-Based Genotyping: Design reliable PCR protocols with appropriate controls to identify wild-type, heterozygous, and homozygous genotypes.

    • Transcript Analysis: Confirm absence or modification of TMEM150A transcript using RT-qPCR.

    • Protein Verification: Validate protein absence using western blotting and immunohistochemistry across multiple tissues.

  • Phenotypic Characterization:

    • Baseline Analysis: Conduct comprehensive phenotyping including viability, fertility, growth curves, behavior, and histological examination of major organs.

    • Immune System Assessment: Given TMEM150A's role in cytokine regulation, analyze immune cell populations and cytokine production at baseline and following immune challenges .

    • Autophagy Evaluation: Examine autophagy markers in tissues with normally high TMEM150A expression, particularly under fasting conditions .

  • Challenge Models:

    • TLR4 Stimulation: Challenge with LPS to assess altered immune responses in vivo, measuring serum cytokine levels and tissue inflammation .

    • Autophagy Induction: Test responses to autophagy-inducing conditions such as starvation or rapamycin treatment.

    • Disease Models: Consider crossing with appropriate disease models (e.g., cancer models given TMEM150A's association with GBM) .

  • Controls and Transparency:

    • Littermate Controls: Always use littermate controls to minimize confounding by genetic background differences.

    • Backcrossing: Maintain the line by backcrossing to a pure genetic background for at least 10 generations.

    • Reporting: Document all methods thoroughly according to ARRIVE guidelines for animal research.

These considerations ensure the development of reliable and informative TMEM150A knockout models that can provide valuable insights into its physiological functions.

How can researchers accurately quantify TMEM150A protein levels in different experimental contexts?

Accurate quantification of TMEM150A protein presents several challenges due to its transmembrane nature. The following methodological approaches can be employed:

  • Western Blot Optimization:

    • Sample Preparation: Use specialized lysis buffers containing appropriate detergents (RIPA with 1% NP-40 or Triton X-100) to efficiently extract membrane proteins.

    • Loading Controls: Select membrane protein-specific loading controls (Na⁺/K⁺-ATPase, cadherin) rather than cytosolic proteins like GAPDH or β-actin.

    • Antibody Validation: Validate antibodies using positive controls (overexpression samples) and negative controls (TMEM150A knockdown or knockout samples).

    • Quantification: Use digital imaging systems with linear dynamic range and implement appropriate normalization.

  • Flow Cytometry:

    • Cell Permeabilization: Optimize permeabilization conditions to access intracellular epitopes while maintaining cell integrity.

    • Antibody Titration: Determine optimal antibody concentrations to minimize background while maximizing specific signal.

    • Controls: Include fluorescence minus one (FMO) controls and isotype controls for accurate gating.

  • Immunohistochemistry/Immunofluorescence:

    • Antigen Retrieval: Test multiple antigen retrieval methods to optimize epitope accessibility in fixed tissues.

    • Signal Amplification: Consider tyramide signal amplification for low-abundance proteins.

    • Quantitative Image Analysis: Use software that allows standardized quantification of signal intensity across samples.

  • Mass Spectrometry-Based Approaches:

    • Selected Reaction Monitoring (SRM): Develop SRM assays targeting unique TMEM150A peptides.

    • Absolute Quantification: Implement AQUA (absolute quantification) using isotope-labeled peptide standards.

    • Sample Fractionation: Employ membrane enrichment protocols prior to mass spectrometry analysis.

  • Proximity Ligation Assay (PLA):

    • This technique can detect and quantify TMEM150A in fixed cells/tissues with high sensitivity and specificity.

    • Particularly useful for detecting TMEM150A interactions with other proteins in their native context.

By employing these complementary approaches and including appropriate controls, researchers can reliably quantify TMEM150A protein levels across various experimental conditions and cellular contexts.

What bioinformatic approaches are recommended for analyzing TMEM150A expression data in cancer datasets?

For robust analysis of TMEM150A expression in cancer datasets, researchers should implement the following bioinformatic approaches:

  • Differential Expression Analysis:

    • Normalization Methods: Apply appropriate normalization techniques (TPM, FPKM, or specialized methods for RNA-seq data) before comparing expression levels.

    • Statistical Testing: Utilize limma, DESeq2, or edgeR for differential expression analysis with multiple testing correction.

    • Effect Size Calculation: Report fold changes and standardized effect sizes in addition to p-values.

  • Survival Analysis:

    • Threshold Determination: Use multiple methods to determine expression thresholds:

      • Median-based dichotomization

      • Optimal cutpoint approaches (e.g., maxstat)

      • Quartile-based stratification

    • Statistical Models: Apply Kaplan-Meier analysis with log-rank tests and Cox proportional hazards models adjusting for relevant clinical covariates .

    • Visualization: Generate Kaplan-Meier curves and forest plots for hazard ratios.

  • Multi-Omics Integration:

    • Correlation Analysis: Examine correlations between TMEM150A expression and other molecular features:

      • Genomic alterations (copy number, mutations)

      • DNA methylation status

      • miRNA regulation

      • Protein expression when available

    • Pathway Analysis: Implement GSEA or similar approaches to identify enriched pathways associated with TMEM150A expression .

  • Immune Microenvironment Analysis:

    • Deconvolution Methods: Apply CIBERSORT, xCell, or MCP-counter to estimate immune cell infiltration from bulk RNA-seq data.

    • Correlation Analysis: Assess relationships between TMEM150A expression and:

      • Immune cell populations (particularly Th17, Th2, and regulatory T cells)

      • Immune checkpoint molecules

      • Stromal and immune scores

  • Visualization and Reporting:

    • Interactive Visualizations: Create interactive heatmaps, volcano plots, and survival curves using tools like plotly or shiny.

    • Reproducible Analysis: Implement analysis pipelines in R or Python with clear documentation.

    • Data Availability: Ensure datasets used for analysis are clearly cited and versions specified.

These approaches have been successfully applied in analyzing TMEM150A in glioblastoma multiforme and can be extended to other cancer types to establish a comprehensive understanding of its role in cancer biology.

How does TMEM150A function compare between mouse models and human systems?

Understanding the similarities and differences in TMEM150A function between mouse and human systems is crucial for translational research:

Understanding these species-specific nuances is essential for effectively translating findings from mouse models to human health applications, particularly in disease contexts where TMEM150A plays a significant role.

What is the relationship between TMEM150A and other members of the TMEM150/DRAM family?

TMEM150A belongs to the TMEM150/DRAM family, which includes several structurally related transmembrane proteins with diverse functions. Understanding their relationships provides context for TMEM150A-specific research:

  • Evolutionary Relationships:

    • The TMEM150/DRAM family comprises TMEM150A, TMEM150B, TMEM150C, and the more distantly related DRAM1 and DRAM2.

    • These proteins share a common evolutionary origin but have diverged to fulfill specialized functions.

  • Structural Similarities and Differences:

    • Family members share a similar topology with multiple transmembrane domains.

    • Specific structural differences, particularly in cytoplasmic domains, likely contribute to their functional specialization.

  • Functional Overlap and Distinction:

    • Autophagy Regulation: Multiple family members have been implicated in autophagy regulation, including TMEM150A and DRAM1 .

    • Signaling Pathway Involvement: DRAM1 has been shown to influence autophagy downstream of TLR4/MyD88 signaling in a prosurvival response to infection , while TMEM150A regulates cytokine production in TLR4 signaling .

    • PI4K Regulation: While TMEM150A regulates PI4KIIIα activity and PI(4,5)P₂ production , other family members may have distinct effects on phosphoinositide metabolism or target different kinases.

  • Expression Patterns:

    • Family members show distinct tissue expression patterns, suggesting tissue-specific functions.

    • In some tissues, multiple family members are co-expressed, raising questions about functional redundancy or cooperation.

  • Research Implications:

    • Compensatory Mechanisms: When studying TMEM150A knockdown or knockout, researchers should consider potential compensatory upregulation of other family members.

    • Specific Inhibitors: Development of inhibitors or activators should consider specificity across family members to avoid off-target effects.

    • Comprehensive Analysis: Studies of TMEM150A would benefit from parallel analysis of other family members to identify shared versus unique functions.

This integrated understanding of the TMEM150/DRAM family provides important context for interpreting TMEM150A-specific findings and may reveal opportunities for therapeutic targeting with enhanced specificity.

How can contradictions in TMEM150A research findings be reconciled across different experimental systems?

Researchers often encounter seemingly contradictory findings about TMEM150A across different experimental systems. These apparent discrepancies can be reconciled through systematic analysis:

  • Cell Type-Specific Effects:

    • TMEM150A may have fundamentally different functions in different cell types. For example, its role in cytokine regulation in epithelial cells may differ from its functions in neurons or cancer cells .

    • Reconciliation Strategy: Directly compare TMEM150A function across multiple cell types under identical experimental conditions while controlling for expression levels.

  • Expression Level Variations:

    • The biological impact of TMEM150A may be dose-dependent, with different phenotypes observed at low versus high expression levels.

    • Reconciliation Strategy: Implement titrated expression systems (inducible promoters) to systematically vary TMEM150A levels and map phenotypic transitions.

  • Context-Dependent Activation:

    • TMEM150A function may be modulated by specific cellular contexts or stimuli. For instance, its role in TLR4 signaling becomes apparent only upon LPS stimulation , while its effects on cytokine homeostasis in H292 cells are observable even without stimulation .

    • Reconciliation Strategy: Test multiple stimulation conditions and time points to capture the full spectrum of TMEM150A functions.

  • Interaction Partner Availability:

    • The function of TMEM150A depends on its interaction with PI4KIIIα and potentially other partners . Variation in the expression or activity of these partners across experimental systems could lead to different outcomes.

    • Reconciliation Strategy: Characterize the expression profiles of known interaction partners in each experimental system and consider their influence on TMEM150A function.

  • Technical Considerations:

    • Knockdown Efficiency: Different siRNAs or shRNAs may achieve varying degrees of knockdown , leading to different phenotypic outcomes.

    • Antibody Specificity: Antibodies used for detection may have different specificities or sensitivities.

    • Assay Sensitivity: Different methods for measuring the same parameter (e.g., cytokine production) may have different sensitivities.

    • Reconciliation Strategy: Standardize technical approaches across laboratories and implement multiple complementary methods to measure key outcomes.

By systematically addressing these factors, researchers can transform apparent contradictions into valuable insights about the context-dependent functions of TMEM150A.

What are promising therapeutic approaches targeting TMEM150A in disease contexts?

Based on current understanding of TMEM150A biology, several therapeutic approaches show promise for disease intervention:

  • Small Molecule Modulators:

    • Inhibitors of TMEM150A-PI4KIIIα Interaction: Small molecules disrupting this interaction could modulate PI(4,5)P₂ production and downstream signaling, potentially beneficial in contexts of dysregulated cytokine production .

    • Allosteric Modulators: Compounds that alter TMEM150A conformation could fine-tune its activity without complete inhibition.

  • RNA-Based Therapeutics:

    • siRNA Delivery Systems: Building on successful siRNA knockdown approaches in cell culture , targeted delivery systems could bring TMEM150A-specific siRNAs to disease sites.

    • Antisense Oligonucleotides: These could be designed to modulate TMEM150A splicing or expression in a tissue-specific manner.

  • Antibody-Based Approaches:

    • Blocking Antibodies: For domains with extracellular exposure, antibodies could block functional interactions.

    • Antibody-Drug Conjugates: In cancer contexts where TMEM150A is overexpressed , this approach could deliver cytotoxic payloads specifically to tumor cells.

  • Disease-Specific Applications:

    • Cancer Therapy: Given its overexpression and correlation with poor prognosis in glioblastoma , TMEM150A inhibition represents a potential therapeutic strategy, particularly if it sensitizes cancer cells to standard treatments.

    • Inflammatory Disorders: Modulating TMEM150A activity could help normalize cytokine production in diseases characterized by dysregulated inflammation .

    • Neurodegenerative Diseases: If TMEM150A's role in autophagy is confirmed, its modulation could potentially address autophagy defects in neurodegenerative conditions.

  • Combination Approaches:

    • Pathway-Targeted Combinations: Combining TMEM150A modulation with inhibitors of downstream pathways might provide synergistic effects.

    • Immune Checkpoint Modulation: In cancer contexts, combining TMEM150A targeting with immune checkpoint inhibitors could potentially enhance anti-tumor immune responses.

Development of these therapeutic approaches requires further validation of TMEM150A as a drug target, including detailed structure-function analyses and comprehensive understanding of its role in both normal physiology and disease states.

What are the key unanswered questions about TMEM150A that warrant further investigation?

Despite progress in understanding TMEM150A biology, several critical questions remain unanswered:

  • Structural Biology Questions:

    • What is the three-dimensional structure of TMEM150A, and how does this structure facilitate its interaction with PI4KIIIα?

    • Are there specific domains or residues critical for TMEM150A's different functions in autophagy versus immune signaling?

  • Regulatory Mechanism Questions:

    • What upstream signals regulate TMEM150A expression and activity in different tissues?

    • How is TMEM150A's function modulated by post-translational modifications?

    • What transcription factors control TMEM150A expression in normal versus disease states?

  • Physiological Function Questions:

    • What is the primary physiological role of TMEM150A in vivo, and how does this vary across tissues?

    • How does TMEM150A contribute to tissue homeostasis under different stress conditions?

    • What are the phenotypic consequences of TMEM150A knockout in animal models?

  • Disease-Related Questions:

    • Beyond glioblastoma , does TMEM150A play significant roles in other cancer types?

    • How does TMEM150A contribute to inflammatory or autoimmune diseases?

    • Could TMEM150A serve as a biomarker for disease progression or treatment response in conditions beyond GBM?

  • Therapeutic Targeting Questions:

    • Is TMEM150A amenable to small molecule targeting, and what structural features could be exploited?

    • Would systemic inhibition of TMEM150A produce unacceptable off-target effects?

    • Can tissue-specific targeting approaches be developed to modulate TMEM150A function in specific disease contexts?

Addressing these questions will require interdisciplinary approaches combining structural biology, molecular and cellular biology, animal models, and clinical studies. The answers will not only advance our fundamental understanding of TMEM150A biology but also inform its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.