Recombinant Mouse Transmembrane protein 158 (Tmem158)

Shipped with Ice Packs
In Stock

Description

Production Data:

ParameterDetails
Expression SystemE. coli
TagN-terminal 10xHis
Purity>95% (SDS-PAGE verified)
Storage-20°C (short-term); -80°C (long-term); avoid freeze-thaw cycles

Research Applications

Recombinant Mouse Tmem158 is widely used to investigate its roles in:

A. Cancer Biology

  • Glioma: Silencing Tmem158 inhibits glioma cell proliferation and migration by suppressing STAT3 activation .

  • Ovarian Cancer: Overexpression correlates with increased tumor adhesion and invasion via TGF-β1 and BMP4 pathways .

  • Pancreatic Cancer: Linked to larger tumor size and poor prognosis; knockdown reduces metastasis in vivo .

B. Cellular Senescence

  • Acts as a downstream effector of Ras pathway activation, triggering irreversible proliferation arrest .

C. Biomarker Development

  • Used in ELISA kits (e.g., MOEB0832) to quantify Tmem158 levels in biological fluids, with a detection range of 0.156–10 ng/mL and sensitivity of 0.081 ng/mL .

Functional Assays and Tools

  • Therapeutic Target: TMEM158 drives epithelial-mesenchymal transition (EMT) in cancers by activating TGF-β and PI3K/AKT pathways .

  • Prognostic Marker: High expression correlates with poor survival in glioblastoma, ovarian cancer, and laryngeal carcinoma .

Challenges and Future Directions

While recombinant Tmem158 has advanced mechanistic studies, limitations include:

  • Lack of crystal structure data for targeted drug design.

  • Species-specific functional differences between mouse and human orthologs .

Ongoing research focuses on developing TMEM158 inhibitors and exploring its role in modulating immune checkpoints like CTLA4 and LAG3 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Tmem158; Mbbp; Ris1; Transmembrane protein 158; 40 kDa BINP-binding protein; p40BBP; Ras-induced senescence protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-286
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem158
Target Protein Sequence
GATDAPGLAGTPPNASANASFTNEHSTPRLLASAASAPPERSGPEEAPAAPCNISVQRQM LSSLLVRWGRPRGLQCDLLLFSTNAHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRL CVGCGWVRGRLRAPAGAPTALPAYPAAEPGPLWLQGEPRHFCCLDFSLEELQGEPGWRLN RKPIESTLVACFMTLVIVVWSVAALIWPVPIIAGFLPNGMEQRRTTAGAPAAAPAAVPAG TTAAAAAAAAAAAAAAAAVTSGVAPK
Uniprot No.

Target Background

Function

Receptor for brain injury-derived neurotrophic peptide (BINP), a synthetic 13-mer peptide.

Database Links

UniGene: Mm.8569

Protein Families
TMEM158 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed. Brain is the major site of expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.