Recombinant Mouse Transmembrane protein 160 (Tmem160)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 160 (TMEM160) is a protein that has been identified in various organisms, including mice. TMEM160 is associated with diverse cellular functions, ranging from mitochondrial processes to tumor development and immune evasion . Recent studies indicate its involvement in cancer progression, making it a potential therapeutic target .

Basic Information

TMEM160 is a transmembrane protein, meaning it spans the cell membrane. It has been found to localize to the inner mitochondrial membrane, where it influences intracellular responses . The protein's structure includes multiple transmembrane domains, which are typical of proteins involved in transport or signaling across cellular membranes .

Physiological Function

  • Mitochondrial Function: TMEM160's presence in the inner mitochondrial membrane suggests a role in mitochondrial processes . Research indicates that depletion of TMEM160 can lead to an upregulation of the mitochondrial unfolded protein response (UPRmt), increased production of reactive oxygen species (ROS), and altered expression of proteins modified by oxidative stress .

  • ROS Suppression: TMEM160 may play a role in suppressing ROS generation and preventing the degradation of certain mitochondrial proteins .

  • Tumorigenesis: TMEM160 is significantly upregulated in lung adenocarcinoma and cervical cancer . Studies have shown that silencing TMEM160 reduces tumor growth in lung adenocarcinoma and cervical cancer cells in vivo .

  • Immune Evasion: TMEM160 promotes tumor immune evasion and radiotherapy resistance by interacting with and stabilizing PD-L1 in colorectal cancer (CRC) . TMEM160 competes with SPOP for binding to PD-L1, reducing the ubiquitination-dependent degradation of PD-L1 .

TMEM160 in Disease

  • Cancer: TMEM160 is associated with tumor growth, metastasis, and radioresistance in colorectal cancer, lung adenocarcinoma, and cervical cancer .

  • Colorectal Cancer (CRC): TMEM160 promotes tumor immune evasion and radiotherapy resistance via PD-L1 binding in CRC . The absence of TMEM160 inhibits proliferation, invasion, metastasis, clonogenicity, and radioresistance of CRC cells, while enhancing the cytotoxic effect of CD8+ T cells on tumor cells .

  • Lung Adenocarcinoma and Cervical Cancer: TMEM160 is significantly upregulated in lung adenocarcinoma and cervical cancer . Silencing TMEM160 reduces tumor growth in these cancer cells in vivo .

Research Findings

  • Study on Colorectal Cancer (CRC):

    • TMEM160 interacts with PD-L1 and stabilizes its expression in CRC cells .

    • TMEM160 competes with SPOP for binding to PD-L1, reducing the ubiquitination-dependent degradation of PD-L1 .

    • Downregulation of TMEM160 restricts tumor growth in immune-competent BALB/c mice .

  • Study on Mitochondrial Function:

    • TMEM160 is localized in the inner mitochondrial membrane .

    • Depletion of TMEM160 leads to an upregulation of the mitochondrial unfolded protein response (UPRmt) .

    • TMEM160 depletion results in a significant increase in reactive oxygen species (ROS) generation .

    • TMEM160 may be involved in suppressing ROS generation and preventing the degradation of some types of mitochondrial protein(s) .

  • Study on Lung Adenocarcinoma and Cervical Cancer:

    • TMEM160 is significantly upregulated in lung adenocarcinoma and cervical cancer .

    • Silencing TMEM160 reduces tumor growth in lung adenocarcinoma and cervical cancer cells in vivo .

Data Tables

Table 1: Effects of TMEM160 Knockdown on CRC Cells

EffectResult
ProliferationSignificantly inhibited
InvasionSignificantly inhibited
MetastasisSignificantly inhibited
ClonogenicitySignificantly inhibited
RadioresistanceSignificantly inhibited
Cytotoxic effect of CD8+ T cellsEnhanced

Table 2: Mitochondrial Responses to TMEM160 Depletion

ResponseEffect
Mitochondrial unfolded protein response (UPRmt)Upregulation
Reactive oxygen species (ROS)Significant increase
Expression of 4-hydroxynonenal-modified proteinsAltered, suggesting enhanced degradation

Table 3: Impact of TMEM160 Silencing on Tumor Growth In Vivo

Cell LineResult
A549 (Lung Adenocarcinoma)Reduced tumor growth and mean weight of xenograft tumors in NOD SCID mice over 33 days
HeLa (Cervical Cancer)Reduced tumor growth and mean weight of xenograft tumors in NOD SCID mice over 40 days

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem160; Transmembrane protein 160
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem160
Target Protein Sequence
MGGGWWWARVARLARLRFRGSLQPPQRPRSGGARGSFAPGHGPRAGASPPPVSELDRADA WLLRKAHETAFLSWFRNGLLSSGIGVISFMQSDMGREAAYGFFLLGGLCVVWGGASYAVG LAALRGPMQLSLAGAAAGVGAVLAASLLWACAVGLYMGQLELDVELVPEDDGAASTEGPD EAGRPPPE
Uniprot No.

Target Background

Database Links
Protein Families
TMEM160 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Mouse Transmembrane protein 160 (Tmem160)?

Recombinant Mouse Transmembrane protein 160 (Tmem160) is a protein encoded by the Tmem160 gene (also known as 1810008O21Rik) that has been produced using recombinant DNA technology in expression systems such as E. coli, yeast, baculovirus, or mammalian cells . The protein is typically purified to ≥85% purity as determined by SDS-PAGE analysis . TMEM160 has been identified as a transmembrane protein localized to the mitochondrial inner membrane, playing roles in multiple cellular processes including mitochondrial function and protein stabilization .

What are the common expression systems used for producing recombinant Tmem160?

Recombinant mouse Tmem160 can be produced using several expression systems, each with distinct advantages. The most common platforms include cell-free expression systems, which offer rapid protein production without cellular constraints . Alternatively, researchers may use E. coli, yeast, baculovirus, or mammalian cell expression systems depending on experimental requirements . The choice of expression system should be guided by downstream applications, desired post-translational modifications, and yield requirements. For structural studies requiring high purity, E. coli or cell-free systems might be preferred, while mammalian expression would be advantageous when studying protein interactions requiring mammalian-specific modifications.

How can I verify the subcellular localization of Tmem160?

Verification of Tmem160's subcellular localization can be accomplished through multiple complementary approaches. Immunofluorescence microscopy using anti-Tmem160 antibodies combined with mitochondrial markers (such as MitoTracker) provides visual confirmation of mitochondrial localization . Subcellular fractionation followed by western blot analysis can determine association with specific mitochondrial compartments. For definitive mitochondrial inner membrane localization, researchers should perform protease protection assays with isolated mitochondria, where outer membrane permeabilization with digitonin would leave inner membrane proteins protected unless the inner membrane is also disrupted . Colocalization with known inner mitochondrial membrane proteins like UQCRC2 (ubiquinol-cytochrome c reductase core protein 2) further confirms proper localization.

What phenotypic changes occur following Tmem160 knockdown in cellular models?

Knockdown of Tmem160 induces several significant phenotypic alterations in cellular models. Most notably, TMEM160 depletion leads to increased reactive oxygen species (ROS) generation, potentially indicating compromised mitochondrial function . This is accompanied by upregulation of the mitochondrial chaperone HSPD1, suggesting activation of mitochondrial stress responses . The expression of key transcription factors that induce the mitochondrial unfolded protein response (UPRmt)—including ATF4, ATF5, and DDIT3—is increased following TMEM160 depletion . Additionally, enhanced expression of mitochondrial protein import receptors TOMM22 and TOMM20 occurs, suggesting compensatory mechanisms to maintain mitochondrial protein homeostasis . These phenotypic changes collectively indicate that Tmem160 plays important roles in maintaining mitochondrial function and redox balance.

What methodologies are optimal for studying Tmem160's role in mitochondrial unfolded protein response (UPRmt)?

To comprehensively investigate Tmem160's role in UPRmt, researchers should employ a multi-faceted approach combining genetic manipulation, biochemical assays, and advanced imaging techniques. Begin with CRISPR/Cas9-mediated knockout or RNAi-based knockdown of Tmem160 in appropriate cell lines . Monitor UPRmt activation by measuring expression levels of canonical markers (HSPD1, ATF4, ATF5, DDIT3) through qRT-PCR and western blotting . For protein-level confirmation, perform immunoprecipitation assays to detect interactions between Tmem160 and UPRmt components.

Mitochondrial function should be assessed through respirometry (Seahorse XF analysis), membrane potential measurements (TMRM staining), and ROS quantification (using CM-H2DCFDA or MitoSOX) . Complementary approaches include mitochondrial protein import assays to determine if Tmem160 affects import efficiency, and proteomic analysis to identify changes in the mitochondrial proteome following Tmem160 depletion. Rescue experiments with wild-type and mutant Tmem160 can establish structure-function relationships. For temporal dynamics, time-course experiments following Tmem160 depletion will reveal primary versus secondary effects on UPRmt signaling.

How does Tmem160 influence reactive oxygen species (ROS) generation and what methodological approaches best measure this relationship?

The relationship between Tmem160 and ROS generation can be investigated using complementary methodological approaches. Knockdown studies have established that TMEM160 depletion leads to increased ROS production, suggesting it normally functions to suppress oxidative stress . To quantify this relationship, employ fluorescent probes specific for different ROS species: CM-H2DCFDA for general cellular ROS, MitoSOX Red for mitochondrial superoxide, and Peroxy Orange for hydrogen peroxide. Flow cytometry and live-cell imaging provide quantitative and spatial information about ROS dynamics.

For mechanistic insights, measure electron transport chain complex activities using spectrophotometric assays following Tmem160 manipulation. Assess mitochondrial membrane potential changes using JC-1 or TMRM dyes, as membrane potential disruption often precedes ROS production. Combine these approaches with measurements of glutathione levels, glutathione peroxidase, and superoxide dismutase activities to evaluate cellular antioxidant capacity . Detection of oxidative damage markers like 4-hydroxynonenal-modified proteins provides functional readouts of ROS effects . N-acetylcysteine treatment experiments can determine whether phenotypes are ROS-dependent or independent. For in vivo validation, transgenic mouse models with tissue-specific Tmem160 deletion coupled with dihydroethidium staining in tissue sections would confirm physiological relevance.

What experimental approaches are most effective for exploring Tmem160's potential interactions with other proteins?

Investigating Tmem160's protein interaction network requires multiple complementary techniques to ensure comprehensive and reliable results. Begin with proximity-based labeling methods such as BioID or APEX2, where Tmem160 is fused to a promiscuous biotin ligase to identify proteins in its proximity within the native cellular environment . Follow with co-immunoprecipitation (co-IP) using antibodies against endogenous Tmem160 or epitope-tagged recombinant versions, coupled with mass spectrometry to identify binding partners .

For direct physical interactions, purify recombinant Tmem160 for in vitro binding assays such as GST pull-down . This approach was successfully used to demonstrate direct binding between TMEM160 and PD-L1 in cancer research . Yeast two-hybrid screening offers another system for identifying direct interactors. Microscopy-based techniques like Förster Resonance Energy Transfer (FRET) or Proximity Ligation Assay (PLA) provide spatial information about interactions within cells. For structural characterization of interactions, employ molecular docking using 3D protein structures from databases like PDB or prediction tools . Cross-validation across multiple techniques is essential, as each method has inherent limitations. Dynamic interactions should be assessed under various cellular conditions (e.g., oxidative stress, mitochondrial dysfunction) to understand context-dependent interaction networks.

What are the best approaches to investigate the functional consequences of Tmem160 post-translational modifications?

Investigating post-translational modifications (PTMs) of Tmem160 requires systematic identification followed by functional characterization. Begin with mass spectrometry-based phosphoproteomics, ubiquitinomics, and other PTM-specific enrichment strategies on purified Tmem160 to identify modification sites . Create site-specific mutants (e.g., phospho-mimetic and phospho-deficient) through site-directed mutagenesis for functional studies. Express these mutants in Tmem160-knockout cells to assess rescue of phenotypes related to ROS generation, UPRmt activation, and protein interactions .

Monitor PTM dynamics under different cellular conditions, especially those that trigger mitochondrial stress or alter redox balance. For ubiquitination studies, perform in vivo ubiquitination assays with HA-tagged ubiquitin following proteasome inhibition . This approach was informative in studies showing TMEM160's role in preventing ubiquitination-dependent degradation of binding partners . For functional relevance, combine PTM detection with activity assays, localization studies, and interaction mapping. Examine PTM crosstalk by simultaneously mutating multiple sites. For physiological context, generate knock-in mice expressing PTM-deficient Tmem160 variants. Computational modeling based on structural data can predict how specific PTMs might alter protein conformation and function.

How should researchers design experiments to resolve contradictions in published data regarding Tmem160's impact on mitochondrial function?

Addressing contradictions in published literature regarding Tmem160's impact on mitochondrial function requires careful experimental design with appropriate controls and multiple methodologies. One study reported that TMEM160 loss does not affect mitochondrial function, while more recent work demonstrated that TMEM160 depletion increases ROS and activates mitochondrial stress responses . To resolve this contradiction:

First, standardize genetic manipulation approaches across experimental systems. Compare acute (siRNA) versus chronic (stable shRNA, CRISPR) depletion strategies to identify time-dependent effects or compensatory mechanisms . Utilize both loss-of-function (knockout, knockdown) and gain-of-function (overexpression) approaches in multiple cell types to account for context-specific effects. Comprehensively assess mitochondrial function using multiple parameters: oxygen consumption rate, ATP production, membrane potential, mtDNA copy number, mitochondrial morphology, and calcium handling .

Examine mitochondrial stress responses through measurement of UPRmt markers, mitophagic flux, and protein import efficiency . Perform proteomics analysis of purified mitochondria to detect subtle changes in protein composition. For physiological relevance, develop tissue-specific Tmem160 knockout mice and evaluate mitochondrial function across tissues with different metabolic demands. Collaborate with groups reporting conflicting results to standardize protocols and reagents. Assess replication stress and cellular senescence as potential confounding factors in long-term depletion studies. Finally, sequence verify all genetically modified cell lines and animals to ensure results are not compromised by off-target effects or genetic drift.

What are the optimal conditions for using recombinant Tmem160 in in vitro binding studies?

For optimal in vitro binding studies with recombinant Tmem160, protein preparation and assay conditions must be carefully controlled. Begin with high-purity (≥85% by SDS-PAGE) recombinant Tmem160 expressed in either E. coli for non-modified protein or mammalian systems when post-translational modifications are important . For transmembrane proteins like Tmem160, consider using detergent-solubilized preparations or incorporating the protein into nanodiscs or liposomes to maintain native conformation.

Buffer composition significantly impacts binding efficiency—start with physiological conditions (pH 7.4, 150 mM NaCl) and optimize through buffer screening. For GST pull-down assays, which have successfully demonstrated TMEM160-PD-L1 interactions, use freshly prepared GST-tagged Tmem160 immobilized on glutathione resin . Control experiments should include GST-only controls and competitive binding assays with known interactors. Temperature optimization (typically 4°C to reduce proteolytic degradation during longer incubations) is essential. Validate binding through multiple techniques, including surface plasmon resonance (SPR) for kinetic and affinity parameters, isothermal titration calorimetry (ITC) for thermodynamic characterization, and microscale thermophoresis (MST) for interactions in solution. Include appropriate positive and negative controls in each experiment, and verify that recombinant Tmem160 retains structural integrity through circular dichroism spectroscopy before binding studies.

How can Tmem160's role in cancer progression be effectively studied in mouse models?

Investigating Tmem160's role in cancer progression requires sophisticated mouse models combined with rigorous analytical approaches. Recent research has implicated TMEM160 in tumor immune evasion through stabilization of PD-L1, suggesting important roles in cancer biology . To study this systematically, develop conditional Tmem160 knockout mouse models using Cre-loxP technology, allowing tissue-specific and temporally controlled deletion. For cancer studies, cross these mice with established tumor models such as ApcMin/+ for colorectal cancer or MMTV-PyMT for breast cancer.

Alternatively, use CRISPR/Cas9-mediated somatic genome editing to modulate Tmem160 expression in specific tissues of wild-type mice. For xenograft studies, implant cancer cells with manipulated Tmem160 expression (knockdown, knockout, or overexpression) subcutaneously or orthotopically into immunocompetent or immunodeficient mice as appropriate . Tumor growth should be monitored by caliper measurements using the formula V = (L × W2)/2, where V, L, and W represent tumor volume, longest diameter, and shortest diameter, respectively .

Perform comprehensive immune profiling of tumor-infiltrating lymphocytes, focusing on CD8+ T cells, given TMEM160's reported role in immune evasion . Analyze expression of TMEM160, PD-L1, and immune markers in tumor tissues through immunohistochemistry, using proper quantification methods like H-score calculation . Test combination therapies with immune checkpoint inhibitors to determine if Tmem160 targeting enhances immunotherapy response. For translational relevance, correlate findings with human cancer data through mining public databases for TMEM160 expression across cancer types and its association with patient outcomes.

What are common technical challenges when working with recombinant Tmem160 and how can they be addressed?

Working with recombinant Tmem160 presents several technical challenges common to transmembrane proteins. Solubility issues often arise during expression and purification—address these by screening different detergents (CHAPS, DDM, digitonin) or using fusion tags that enhance solubility (MBP, SUMO) . Low expression yields can be improved by optimizing codon usage for the expression host, reducing culture temperature during induction, or switching to expression systems better suited for membrane proteins (insect cells or cell-free systems) .

Protein aggregation during storage and handling can be minimized by including glycerol (10-20%) in storage buffers, avoiding freeze-thaw cycles, and maintaining protein at appropriate concentrations. For functional studies, protein refolding may be necessary—develop step-wise dialysis protocols to remove denaturing agents gradually. When antibody detection is inconsistent, validate antibodies using positive controls (overexpression lysates) and negative controls (knockout/knockdown samples).

For interaction studies, non-specific binding can confound results—optimize washing conditions and include appropriate blocking agents (BSA, non-fat milk) . When studying Tmem160's effects on mitochondrial function, difficulty isolating pure mitochondrial fractions may arise—implement density gradient purification rather than simple differential centrifugation. For knockdown studies where phenotypes are variable, use multiple siRNA/shRNA sequences to confirm specificity and implement rescue experiments with siRNA-resistant constructs . Address potential off-target effects by using CRISPR/Cas9 knockout models alongside RNAi approaches. Finally, when contradictory results emerge between assays, systematically troubleshoot by standardizing experimental conditions and employing orthogonal methods to validate findings.

How can researchers accurately assess and minimize off-target effects when performing Tmem160 knockdown or knockout experiments?

Minimizing and accurately assessing off-target effects in Tmem160 genetic manipulation studies requires systematic validation approaches. For siRNA/shRNA knockdown experiments, design multiple non-overlapping sequences targeting different regions of Tmem160 mRNA . Compare phenotypes across these different constructs—consistent results across multiple sequences suggest on-target effects. Use scrambled sequences with similar GC content as negative controls, and include rescue experiments by expressing siRNA-resistant Tmem160 cDNA (containing synonymous mutations in the targeted region) .

For CRISPR/Cas9 knockout approaches, design multiple guide RNAs with high specificity scores and minimal predicted off-targets. Validate edits through sequencing and protein expression analysis. Generate multiple independent knockout clones and verify consistent phenotypes across them. Perform whole-genome or exome sequencing on edited lines to identify potential off-target mutations. Include rescue experiments by reintroducing wild-type Tmem160 expression.

Use complementary approaches like pharmacological inhibition (if specific inhibitors exist) to corroborate genetic manipulation results. For transcriptome analysis, compare gene expression changes between different knockdown/knockout methods to identify consistent versus method-specific alterations. When analyzing phenotypes related to mitochondrial function, mitochondrial stress, or ROS production, use multiple independent assays to confirm observations . If working with cell lines prone to genetic drift, maintain low passage numbers and regularly sequence verify key regions. For in vivo studies, use tissue-specific or inducible knockout systems to minimize developmental compensation, and generate heterozygous animals to assess gene dosage effects.

What are promising research directions for elucidating Tmem160's role in mitochondrial-nuclear communication pathways?

Exploring Tmem160's involvement in mitochondrial-nuclear communication represents a promising frontier given its roles in mitochondrial function and stress responses. Future research should investigate whether Tmem160 depletion affects translocation of mitochondrial proteins to the nucleus or alters nuclear gene expression programs responsive to mitochondrial dysfunction . Chromatin immunoprecipitation sequencing (ChIP-seq) of transcription factors activated during the UPRmt (ATF4, ATF5, DDIT3) following Tmem160 manipulation would reveal genome-wide binding patterns and target genes .

Researchers should examine if Tmem160 influences retrograde signaling metabolites like acetyl-CoA, α-ketoglutarate, or NAD+/NADH ratios that affect nuclear histone modifications and gene expression. Proximity labeling approaches (BioID, APEX) with Tmem160 as bait could identify interacting partners at the mitochondrial-nuclear interface. Studies of mitochondrial DNA release and cytosolic sensing pathways (cGAS-STING) following Tmem160 depletion might uncover roles in inflammatory signaling.

Single-cell multiomics approaches combining transcriptomics and metabolomics could reveal cell-to-cell variability in responses to Tmem160 perturbation. Tissue-specific conditional knockout mice would help determine if Tmem160's functions in mitochondrial-nuclear communication vary across tissues with different metabolic demands. Finally, investigating if Tmem160 affects mitochondrial DNA copy number regulation, mitochondrial dynamics, or mitophagy could reveal broader roles in maintaining mitochondrial homeostasis and quality control that impact nuclear signaling pathways.

How might the interplay between Tmem160 and the immune system be further investigated beyond current cancer research findings?

The discovery that TMEM160 influences tumor immune evasion through PD-L1 stabilization opens avenues for broader investigation of its immunomodulatory functions . Future research should examine Tmem160 expression and function in immune cells themselves, particularly in professional antigen-presenting cells like dendritic cells and macrophages. Single-cell RNA sequencing of tumor microenvironments with modulated Tmem160 expression would provide comprehensive mapping of immune infiltration patterns and activation states.

Beyond PD-L1, researchers should investigate if Tmem160 affects other immune checkpoint molecules using proteomics and targeted validation. Given Tmem160's mitochondrial localization and influence on ROS, studies should explore connections between Tmem160, metabolic reprogramming in immune cells, and immunometabolism . Creating conditional Tmem160 knockout mice specifically in immune cell lineages would allow in vivo assessment of its function in normal immune development and responses.

For translational applications, testing whether Tmem160 inhibition synergizes with established immunotherapies beyond PD-1/PD-L1 blockade would be valuable . Investigating Tmem160's role in non-cancer immune contexts, such as autoimmune diseases, infectious disease responses, and vaccine-induced immunity, could reveal broader immunoregulatory functions. Finally, examining if Tmem160 influences innate immune signaling through mitochondrial damage-associated molecular patterns (DAMPs) or affects activation of the NLRP3 inflammasome would connect its mitochondrial functions to inflammatory responses critical in multiple disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.