Recombinant Mouse Transmembrane protein 169 (Tmem169)

Shipped with Ice Packs
In Stock

Description

Expression and Tissue Distribution

RNA sequencing reveals high Tmem169 expression in the mouse central nervous system (CNS):

TissueExpression Level (RPKM)Developmental Stage
CNS E187.1Embryonic day 18
CNS E146.4Embryonic day 14
Cerebellum0.795Adult
Fetal brain1.583Prenatal

This CNS-predominant expression pattern aligns with its role in neurodevelopment .

Functional Insights from Knockout Studies

Cortex-specific Tmem169 deletion in mice causes:

  • Neuronal dendritic arborization defects (−42% complexity vs wild-type)

  • Synaptic density reduction (−35% in hippocampal neurons)

  • Autism-like behaviors (impaired social interaction, repetitive behaviors)

Mechanistically, Tmem169 interacts with Shank3 (a key synaptic scaffolding protein) and modulates:

  1. Actin cytoskeleton reorganization

  2. AMPA receptor trafficking

  3. Synaptogenesis pathways

Protein Interaction Studies

Used with co-immunoprecipitation (Co-IP) to map binding partners:

  • Shank3: Critical for postsynaptic density assembly

  • Homer1: Metabotropic glutamate receptor signaling

  • PSD-95: Synaptic plasticity regulation

Biochemical Assays

  • ELISA Detection: Commercial kits (e.g., MBS9338480 , Abbexa TMEM169 Kit ) achieve linear detection between 0.156–10 ng/ml in tissue homogenates

  • Antibody Validation: Used as a positive control for antibodies like PA5-64449 at 100x molar excess

Technical Considerations

  • Endotoxin Levels: <1.0 EU/μg (critical for in vivo studies)

  • Batch Consistency: Inter-assay CV <8% in quality-controlled lots

  • Species Cross-Reactivity: 89% sequence identity with rat orthologs

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Tmem169; Transmembrane protein 169
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-297
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem169
Target Protein Sequence
MEESAPVESQGQLPSPHHGSLRRAVAAVLALDGESTLGRRKKRRKDSRPESIIIYRSDNE KTDEEPEESEGGDRPKEEEGEDFLDYPGDDGVWNMPLDSRYVTLTGTITRGKKKGQMVDI HVTLTEKELQELTKPKELSREAAPEGRRACQVGADQGPHVVLWTLVCLPVVFVLSFVVSF YYGTITWYNIFLVYNEERTFWHKISCCPCLILFYPVLIMTMASSLGLYAAVAQLSWSWAA WWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISGNLSNKDPIQEVETSTV
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane protein 169 (TMEM169) and where is it expressed?

Mouse Transmembrane protein 169 (TMEM169) is a membrane-spanning protein identified by the UniProt Primary Accession number Q8BG50 (UniProt Entry Name: TM169_MOUSE). The gene encoding this protein is located at GeneID 271711 . Like other transmembrane proteins, TMEM169 contains hydrophobic domains that anchor it within cellular membranes. Though specific tissue expression patterns are not fully characterized, transmembrane proteins of this family can be detected in various tissue homogenates, cell lysates, and biological fluids using appropriate analytical methods .

TMEM169 belongs to the broader family of transmembrane proteins that perform diverse cellular functions including signaling, transport, and structural organization. While the specific function of TMEM169 remains under investigation, research on related TMEM family proteins suggests potential roles in cellular homeostasis, membrane organization, and possibly neurological function, as several TMEM proteins have been studied in relation to neurological disorders .

What are the molecular characteristics of Mouse TMEM169?

Mouse TMEM169 is encoded by the TMEM169 gene (GeneID: 271711). While detailed structural information is limited, general characteristics can be inferred from database information and research on similar transmembrane proteins:

CharacteristicInformation
UniProt Primary ACQ8BG50
UniProt Entry NameTM169_MOUSE
Gene SymbolTMEM169
GeneID271711
Protein FamilyTransmembrane protein family
Detectable Range (ELISA)0.156 ng/ml - 10 ng/ml

The protein likely features multiple transmembrane domains that anchor it within cellular membranes, similar to other TMEM family proteins which typically contain 4-6 transmembrane helices . The membrane topology and tertiary structure would be critical for its biological function, though specific structural details remain to be fully elucidated.

How is recombinant Mouse TMEM169 typically produced and purified?

Recombinant TMEM169 production generally follows standard recombinant protein expression protocols with modifications specific to membrane proteins. The process typically involves:

  • Gene cloning: Similar to the approach used for other transmembrane proteins, the TMEM169 gene would be PCR-amplified from mouse cDNA and cloned into an appropriate expression vector using restriction enzymes (such as BamHI and EcoRI) and ligation with T4 DNA ligase .

  • Expression system selection: E. coli BL21(DE3) is commonly used for initial expression attempts , but for membrane proteins like TMEM169, eukaryotic expression systems such as yeast, insect cells, or mammalian cells may provide better folding and post-translational modifications.

  • Protein extraction and purification: Detergent-based extraction methods are typically required to solubilize membrane proteins from cell membranes, followed by affinity chromatography (if tagged) and size-exclusion chromatography to achieve purity.

It's important to note that membrane proteins like TMEM169 often present unique challenges in recombinant expression due to their hydrophobic nature and complex folding requirements. Commercial ELISA kits for native TMEM169 detection explicitly mention that "our kits are optimised for detection of native samples, rather than recombinant proteins" and that they "are unable to guarantee detection of recombinant proteins, as they may have different sequences or tertiary structures to the native protein" .

What experimental design principles should be followed when studying recombinant TMEM169?

When designing experiments involving recombinant TMEM169, researchers should apply rigorous experimental design principles to ensure valid and reliable results:

  • Variable definition: Clearly define independent variables (e.g., TMEM169 concentration, treatment conditions) and dependent variables (e.g., binding affinity, cellular response) at the outset of experimental planning .

  • Control implementation: Include appropriate positive and negative controls. For TMEM169 studies, controls might include:

    • Vehicle-only conditions

    • Inactive/mutant TMEM169 variants

    • Related transmembrane proteins for specificity assessment

  • Variable control: Identify and control potential confounding variables including temperature, pH, sample handling procedures, and cell culture conditions .

  • Replication strategy: Design with sufficient biological and technical replicates to ensure statistical power. For membrane protein studies, variability can be higher than soluble proteins, potentially requiring additional replicates.

  • Randomization and blinding: Where applicable, implement randomization of sample processing and blinded analysis to minimize unconscious bias .

When investigating transmembrane proteins like TMEM169, considerations specific to membrane proteins should be incorporated into the experimental design, including detergent selection, buffer optimization, and membrane mimetic systems.

How can researchers optimize the detection of Mouse TMEM169 using ELISA methods?

Optimizing ELISA-based detection of TMEM169 requires attention to several critical parameters:

  • Sample preparation: For tissue homogenates, cell lysates, and biological fluids, proper extraction protocols are essential. Sample concentrations must be diluted to mid-range of the kit (0.156 ng/ml - 10 ng/ml) for accurate results .

  • Storage and stability considerations: ELISA kits should be stored according to manufacturer instructions. The typical stability for TMEM169 ELISA kits shows an activity loss rate of less than 5% within the expiration date under appropriate storage conditions .

  • Assay standardization: Use of standard curves with known concentrations of TMEM169 is critical. Most commercial kits provide lyophilized standards that must be carefully reconstituted .

  • Technical consistency: To minimize performance fluctuations, operation procedures and lab conditions should be strictly controlled. Having the same user perform the entire assay is strongly recommended .

  • Validation approaches: Cross-validation with alternative detection methods (e.g., Western blotting, immunofluorescence) can confirm ELISA findings.

Optimization ParameterRecommendation
Sample dilutionTarget mid-range of detection (0.156-10 ng/ml)
Temperature controlStore kit at 4°C; follow temperature guidelines for each step
Technical variabilitySame user should perform entire assay
Standard curve range0.156 ng/ml - 10 ng/ml (with appropriate dilutions)
Detection methodColorimetric detection optimized for quantitative analysis

What are the current methodological challenges in studying recombinant TMEM169?

Several methodological challenges exist when working with recombinant TMEM169:

  • Protein folding and structure: Transmembrane proteins often misfold when expressed recombinantly, especially in prokaryotic systems. This can lead to inclusion body formation, aggregation, or incorrectly folded proteins lacking native function.

  • Detection limitations: Commercial detection reagents are typically optimized for native proteins and may have reduced affinity for recombinant versions. As noted in ELISA kit documentation: "We are unable to guarantee detection of recombinant proteins, as they may have different sequences or tertiary structures to the native protein" .

  • Functional validation: Confirming that recombinant TMEM169 maintains native functionality is challenging due to limited knowledge of its physiological function.

  • Expression system selection: Choosing appropriate expression systems is critical. While bacterial systems like E. coli are commonly used for recombinant protein production , membrane proteins often require eukaryotic expression systems for proper folding and post-translational modifications.

  • Protein-membrane interactions: Studying transmembrane proteins outside their native membrane environment may not accurately reflect their natural behavior, necessitating the use of membrane mimetics.

How can TMEM169 research benefit from approaches used with other TMEM family proteins?

Research methodologies applied to other TMEM family proteins can inform approaches to TMEM169 investigation:

  • Genetic analysis techniques: The approach used to study TMEM230, TMEM175, TMEM163, TMEM229B, TMEM108, and TMEM59 in Parkinson's disease research provides a useful template. This includes variant identification, filtering processes, and statistical analysis approaches like the optimized sequence kernel association test (SKAT-O) .

  • Structural characterization: Schematic mapping of transmembrane regions, as performed for other TMEM proteins, can be applied to TMEM169. This involves computational prediction and experimental validation of transmembrane domains .

  • Variant analysis: Techniques for identifying rare missense variants, rare damaging missense variants, and loss-of-function variants can be adapted from studies of other TMEM genes. The Combined Annotation Dependent Depletion (CADD) algorithm and other pathogenicity prediction tools can be applied to TMEM169 variants .

  • Functional studies: Approaches used to characterize the functions of related TMEM proteins, such as gene knockout/knockdown models, protein-protein interaction studies, and subcellular localization analyses, can provide frameworks for TMEM169 investigation.

  • Cross-species comparisons: Comparative analyses of TMEM proteins across species can provide insights into evolutionary conservation and functional importance of specific domains.

What immune response considerations are relevant when working with recombinant TMEM169?

When designing studies involving immune responses to recombinant proteins like TMEM169, several factors should be considered:

  • Adjuvant selection: Choice of adjuvant significantly impacts the type and magnitude of immune response. Freund's complete adjuvant is commonly used in research settings, as observed in studies with other recombinant proteins .

  • Immune response profiling: Comprehensive immune profiling should include:

    • Antibody production (IgG levels)

    • Cytokine profiling (e.g., IL-4, IL-10, IFN-γ) to determine Th1/Th2 balance

    • Cell-mediated responses

  • Dosage optimization: Dosage affects immune response quality and quantity. Typical experimental protocols with recombinant proteins use approximately 100 μg of protein per immunization in mouse models .

  • Administration route: The route of administration (e.g., subcutaneous, intraperitoneal, intranasal) influences the type of immune response generated. Subcutaneous administration is commonly used in mouse models for recombinant protein studies .

  • Cross-reactivity assessment: When working with recombinant proteins, it's important to evaluate potential cross-reactivity with other host proteins to avoid misleading results or unintended immune responses.

Immunization ParameterTypical Approach Based on Related Research
Protein dose100 μg per immunization
Administration routeSubcutaneous
AdjuvantFreund's complete adjuvant
Immune response analysisIgG antibody titers, cytokine profiling (IL-4, IL-10, IFN-γ)
Control groupsPBS control, related protein control

How can mouse models be effectively utilized for TMEM169 functional studies?

Mouse models represent valuable tools for studying TMEM169 function in vivo. Based on approaches used with related proteins:

  • Model selection considerations:

    • Wild-type vs. genetically modified mice (knockout, knockin, transgenic)

    • Background strain selection based on research question

    • Age and sex considerations for reducing variability

  • Experimental design for immunological studies: When evaluating immune responses to recombinant TMEM169, experimental groups should include:

    • Negative control group (PBS with adjuvant)

    • Recombinant protein group (TMEM169)

    • Combination groups (if studying TMEM169 with other proteins)

    • Appropriate sample sizes (typically 10 mice per group)

  • Tissue-specific expression analysis: Investigating tissue-specific expression patterns of TMEM169 using techniques such as:

    • qRT-PCR for mRNA expression

    • Immunohistochemistry for protein localization

    • In situ hybridization for spatial expression patterns

  • Phenotypic characterization: Comprehensive phenotyping approaches including:

    • Behavioral testing (if neurological function is hypothesized)

    • Physiological measurements

    • Biochemical analyses

    • Histopathological examination

  • Data analysis and statistical considerations: Proper statistical approaches including covariate control (sex, age, genetic background) similar to approaches used in TMEM gene studies .

What common challenges arise in recombinant TMEM169 production and how can they be addressed?

Recombinant production of transmembrane proteins like TMEM169 presents several challenges:

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage, test multiple expression systems, use fusion tags to enhance solubility, and consider specialized expression strains.

  • Protein misfolding:

    • Challenge: Incorrect folding in recombinant systems, especially prokaryotic ones.

    • Solution: Use eukaryotic expression systems, optimize growth temperature (often lower temperatures improve folding), add chemical chaperones, or express as fusion with solubility-enhancing partners.

  • Protein aggregation:

    • Challenge: Formation of inclusion bodies or aggregates.

    • Solution: Optimize solubilization conditions, use appropriate detergents, consider refolding protocols if necessary, and explore membrane mimetic systems.

  • Functional validation:

    • Challenge: Confirming that recombinant TMEM169 retains native function.

    • Solution: Develop functional assays based on predicted protein function, compare with native protein where possible, and assess structural integrity through biophysical methods.

  • Purification difficulties:

    • Challenge: Maintaining protein stability during purification.

    • Solution: Optimize detergent selection, include stabilizing agents in buffers, minimize purification steps, and consider on-column folding techniques.

How can researchers validate the authenticity and functionality of recombinant TMEM169?

Validation of recombinant TMEM169 should include multiple complementary approaches:

  • Sequence verification: Confirm the DNA sequence of the expression construct and the protein sequence (through mass spectrometry) against the reference sequence (UniProt: Q8BG50) .

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Size-exclusion chromatography to evaluate homogeneity

    • Dynamic light scattering to detect aggregation

    • Thermal stability assays to assess protein folding

  • Functional validation:

    • Binding assays with known or predicted interaction partners

    • Activity assays based on predicted function

    • Cellular localization studies when expressed in mammalian cells

  • Antibody recognition: Verification that antibodies against native TMEM169 recognize the recombinant form, though with the caveat that "kits are optimised for detection of native samples, rather than recombinant proteins" .

  • Comparative analysis: Where possible, compare properties of recombinant TMEM169 with native protein extracted from appropriate mouse tissues.

What quality control parameters should be monitored for recombinant TMEM169 preparations?

Rigorous quality control is essential for reliable research with recombinant TMEM169:

Quality Control ParameterMethodAcceptance Criteria
PuritySDS-PAGE, Size-exclusion chromatography>90% purity by densitometry
IdentityMass spectrometry, Western blotMatches predicted mass, recognized by specific antibodies
HomogeneityDynamic light scattering, Size-exclusion chromatographyMonodisperse population, minimal aggregation
Endotoxin levelsLAL test<1 EU/mg protein for cell culture applications
Functional activityBinding assays, structural assaysActivity comparable to reference standard
StabilityAccelerated stability testing, activity retention<5% activity loss under storage conditions

Batch-to-batch consistency is crucial for reproducible research. Documentation should include production date, expression system, purification method, buffer composition, concentration, and any observed batch-specific characteristics.

How might TMEM169 research intersect with studies of neurological disorders?

Based on research trends with other transmembrane proteins, TMEM169 could have potential implications for neurological research:

  • Genetic association studies: Several TMEM family proteins have been investigated in relation to Parkinson's disease and other neurological disorders. Similar approaches could be applied to explore potential associations between TMEM169 variants and neurological conditions .

  • Functional characterization in neural tissues: Expression pattern analysis in neural tissues could reveal potential roles in brain development or function. Other TMEM proteins have demonstrated tissue-specific functions in the nervous system.

  • Protein-protein interaction networks: Identifying interaction partners of TMEM169 in neural tissues could place it within signaling networks relevant to neurological function or dysfunction.

  • Animal models: Development of TMEM169 knockout or transgenic mouse models could reveal phenotypes relevant to neurological disorders, following approaches used with other TMEM proteins .

  • Therapeutic target potential: If functional studies establish a role for TMEM169 in disease-relevant processes, it could represent a novel therapeutic target, particularly if positioned within druggable cellular pathways.

What emerging technologies might advance TMEM169 research?

Several cutting-edge technologies hold promise for advancing our understanding of TMEM169:

  • Cryo-electron microscopy: This technique has revolutionized membrane protein structural biology and could provide detailed structural insights into TMEM169.

  • Single-cell analysis methods: Single-cell RNA-seq and proteomics could reveal cell-type specific expression patterns of TMEM169 in complex tissues.

  • CRISPR-Cas9 genome editing: Precise modification of TMEM169 in cell lines and animal models could facilitate functional studies and disease modeling.

  • Protein engineering approaches: Directed evolution and rational design could improve recombinant TMEM169 production and facilitate structure-function studies.

  • Advanced imaging techniques: Super-resolution microscopy and correlative light and electron microscopy could provide insights into TMEM169 localization and dynamics in cellular contexts.

  • Computational modeling: Advances in protein structure prediction (like AlphaFold) and molecular dynamics simulations could provide insights into TMEM169 structure and function when experimental data is limited.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.