Recombinant Mouse Stimulator of interferon genes protein (Sting1)

Shipped with Ice Packs
In Stock

Description

Immune Signaling

  • Cyclic Dinucleotide Sensing: Binds bacterial c-di-GMP or host-derived cGAMP, triggering oligomerization and ER-to-Golgi translocation .

  • IRF3 Activation: Phosphorylated by TBK1, inducing type I interferons (IFN-α/β) via IRF3 nuclear translocation .

  • Autophagy Induction: Drives COPII vesicle formation from the ER, recruiting WIPI2 and LC3 for autophagosome generation .

Non-Canonical Roles

  • Nuclear STING1: Competes with cytoplasmic signaling by activating aryl hydrocarbon receptor (AHR) to regulate gut microbiota .

  • Cell Death Modulation: Promotes ferroptosis in tumors and mitotic death via BCL-XL inhibition .

Key Findings

Model/StudyFindingsReference
Cerebral MalariaSTING1 in brain endothelial cells drives IFNβ production, exacerbating blood-brain barrier disruption .
SAVI PathogenesisHAQ/AQ allele mutations in Sting1 rescue CD4+ T cell depletion by inhibiting STING1-mediated apoptosis .
Antiviral DefenseAutophagy-dependent HSV-1 clearance in dendritic cells requires STING1 but not TBK1 .

Recent Advances (2022–2024)

  • Organelle-Specific Roles: STING1 localizes to mitochondria, lysosomes, and nuclei, expanding its functions beyond ER-Golgi trafficking .

  • Disease Links: Chronic STING1 activation promotes pancreatic cancer via ferroptosis-driven inflammation , while Q293 mutations confer resistance to agonist-induced cell death .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sting1; Eris; Mita; Mpys; Tmem173; Stimulator of interferon genes protein; mSTING; Endoplasmic reticulum interferon stimulator; ERIS; Mediator of IRF3 activation; MMITA; Transmembrane protein 173
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLL KNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMF GLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRM FNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYS NSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILED VPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEP RLLISGMDQPLPLRTDLI
Uniprot No.

Target Background

Function
Stimulator of interferon genes (STING1) is a critical facilitator of innate immune signaling that acts as a sensor of cytosolic DNA originating from bacteria and viruses. It promotes the production of type I interferon (IFN-alpha and IFN-beta), a key component of the antiviral response. The innate immune response is triggered upon detection of non-CpG double-stranded DNA from viruses and bacteria that enters the cytoplasm. STING1 recognizes and binds to cyclic dinucleotides, including cyclic di-GMP (c-di-GMP), a bacterial second messenger, and cyclic GMP-AMP (cGAMP), a messenger produced by cyclic GMP-AMP synthase (cGAS) in response to DNA viruses in the cytosol. Binding of c-di-GMP or cGAMP induces STING1 oligomerization, causing it to translocate from the endoplasmic reticulum to the Golgi apparatus. Subsequently, STING1 is phosphorylated by TANK-binding kinase 1 (TBK1) on the pLxIS motif, leading to the recruitment and activation of the transcription factor interferon regulatory factor 3 (IRF3). This activation triggers the expression of type I interferon, establishing a potent antiviral state within the cell. Beyond promoting the production of type I interferons, STING1 plays a direct role in autophagy, a cellular process for degrading damaged components. Upon binding cGAMP, STING1 buds from the endoplasmic reticulum into COPII vesicles, which then form the endoplasmic reticulum-Golgi intermediate compartment (ERGIC). This ERGIC serves as the membrane source for WIPI2 recruitment and LC3 lipidation, leading to the formation of autophagosomes that target cytosolic DNA or DNA viruses for degradation by the lysosome. Notably, the autophagy-inducing and interferon-inducing activities can be uncoupled, and autophagy induction is independent of TBK1 phosphorylation. Autophagy is also triggered upon infection by bacteria: following c-di-GMP-binding, which is produced by live Gram-positive bacteria, STING1 promotes reticulophagy, a specific form of autophagy targeting the endoplasmic reticulum. STING1 exhibits 2',3' phosphodiester linkage-specific ligand recognition, capable of binding both 2'-3' linked cGAMP (2'-3'-cGAMP) and 3'-3' linked cGAMP, but is preferentially activated by 2'-3' linked cGAMP. This preference is attributed to the ligand's organized free-ligand conformation, which resembles the STING1-bound conformation and requires minimal energy to transition into the active conformation. STING1 may be involved in translocon function, a process potentially influencing the induction of type I interferons. It might also participate in the transduction of apoptotic signals through its association with the major histocompatibility complex class II (MHC-II).
Gene References Into Functions
  1. Mice lacking Ubxn3b, similar to Sting-deficient mice, exhibit heightened susceptibility to lethal herpes simplex virus 1 (HSV-1) and vesicular stomatitis virus (VSV) infection. This susceptibility is correlated with deficient immune responses compared to their Ubxn3b-expressing counterparts. PMID: 29899553
  2. This study revealed that STING-deficient mice display defective protective mechanisms in the intestinal mucosa, including reduced numbers of goblet cells, diminished mucus production, and lower levels of secretory IgA. PMID: 29346345
  3. In response to cytosolic DNA, STING translocates from the endoplasmic reticulum (ER) to the Golgi apparatus, activating TANK-binding kinase 1 (TBK1), a cytosolic kinase essential for the activation of STING-dependent downstream signaling. Importantly, TBK1 binds to STING at the Golgi, not at the ER. PMID: 29870684
  4. Usp13, a deubiquitinase, removes polyubiquitin chains from STING, preventing the recruitment of Tbk1 to the signaling complex and negatively regulating cellular antiviral responses. PMID: 28534493
  5. STING-mediated innate immune responses and dendritic cell maturation do not require TICAM-1 in myeloid lineage immune cells. PMID: 29627569
  6. PUMA promotes the cytosolic release of mitochondrial DNA, activating the DNA sensors DAI/Zbp1 and STING, leading to enhanced RIP3 and MLKL phosphorylation in a positive feedback loop. PMID: 29581256
  7. This research identified nitro-fatty acids as endogenously formed inhibitors of STING signaling. These lipids are proposed as potential candidates for treating STING-dependent inflammatory diseases. PMID: 30061387
  8. Mice deficient in cyclic GMP-AMP synthase (cGAS) or STING protein (STING) exhibit high susceptibility to acute herpes simplex encephalitis (HSE). PMID: 27830700
  9. The STING/type I interferon pathway enhances suppressive inflammation in tumors by recruiting myeloid cells, partially through the CCR2 pathway. Blocking CCR2 genetically or with an anti-CCR2 antibody inhibits radiation-induced MDSC infiltration. PMID: 29170400
  10. Induction of STING signaling is contingent on a precise regulation of intracellular calcium levels. PMID: 29673589
  11. STING was found to be dispensable for restricting Streptococcus pneumoniae during acute pneumonia in mice. PMID: 29263110
  12. Data demonstrate that numerous RNA viruses evade cGAS/STING-dependent signaling, highlighting the importance of this pathway in shaping the host range of Zika virus. PMID: 29915078
  13. Immune activation of STING requires palmitoylation at the Golgi apparatus. PMID: 27324217
  14. STING exhibits dual functions in host defense, regulating protein synthesis to prevent RNA virus infection and modulating IFN expression to restrict DNA viruses. PMID: 29440426
  15. This research provides biochemical and imaging evidence for STING degradation by the lysosome. It identifies trafficking-mediated STING degradation as a potential therapeutic target for enhancing STING signaling in cancer therapy. PMID: 29241549
  16. The cGAS-STING cascade contributes to antibacterial defense against Legionella pneumophila in mice and humans. This study sheds light on how the common HAQ TMEM173/STING variant affects antimicrobial immune responses and susceptibility to infection. PMID: 29298342
  17. DsbA-L, a protein involved in protein disulfide bond formation, prevents obesity-induced inflammation and insulin resistance by suppressing the mtDNA release-activated cGAS-cGAMP-STING pathway. PMID: 29087318
  18. Nontypeable Haemophilus influenzae DNA, as a pathogen-associated molecular pattern, triggered I-IFN response, which was dependent on STING/TBK1/IRF3. PMID: 29421524
  19. Intratumoral administration of the STING agonist cyclic di-GMP (CDG) or Flt3 Ligand (Flt3L) augmented the therapeutic effect of systemic triple checkpoint modulation, leading to the cure of 75% of mice with bilateral TRAMP-C2 tumors. However, when all agents were administered locally, only CDG mobilized abscopal immunity. PMID: 28674082
  20. This research provides genetic evidence that cell-autonomous control of lentivirus infection in myeloid cells by SAMHD1 limits virus-induced production of interferons and the induction of co-stimulatory markers. PMID: 27477283
  21. Mouse primary T cells and T leukemia cells exhibit hyperresponsiveness to STING agonists. This strong STING signaling is associated with apoptosis induction. PMID: 28874664
  22. STING-regulated pathways underlie the pathogenesis of numerous diseases, including infectious diseases and cancers. Studies have established STING as a promising therapeutic target for cancer treatment. PMID: 26980676
  23. STING activated an antiviral/type I interferon response with live but not killed Staphylococcus aureus. PMID: 28704551
  24. Data indicate that the STING N153S mutation associated with STING-associated vasculopathy with onset in infancy (SAVI) triggers IRF3-independent immune cell dysregulation and lung disease in mice. PMID: 28951494
  25. These findings highlight the crucial role of MFN1 in maintaining the competency of the STING pathway. PMID: 28729291
  26. This research elucidates stress-mediated endoplasmic reticulum-phagy as a cell-autonomous response mobilized by STING-dependent sensing of specific vita-pathogen-associated molecular patterns. It clarifies how innate receptors engage multilayered homeostatic mechanisms to promote immunity and survival after infection. PMID: 29056340
  27. To contain the spread of herpes simplex virus type 1 in vivo, STING-dependent signaling leads to the upregulation of tetherin, a viral restriction factor. PMID: 26627457
  28. This study identifies the AIM2 inflammasome and cGAS/IFI16-STING-type I IFN pathway as a novel mechanism for host innate immunity to the ALVAC vaccine vector. PMID: 28947539
  29. NEMO was found to be critically involved in the cGAS-STING pathway. PMID: 28939760
  30. This research found that CCCP, a mitochondrial uncoupler, impairs the interaction between STING and TBK1, simultaneously triggering mitochondrial fission. PMID: 28859978
  31. Yersinia YopJ, a bacterial effector protein, negatively regulates IRF3-mediated antibacterial response by disrupting STING-mediated cytosolic DNA signaling. PMID: 27742471
  32. This study provides evidence of STING activation in T cells, where STING agonists not only provoke type I IFN production and IFN-stimulated gene expression, mirroring the response of innate cells, but also activate cell stress and death pathways. PMID: 28615418
  33. In a colon tumor model, therapeutic anti-CD47 preferentially relies on STING-mediated DNA sensing in dendritic cells. PMID: 28801234
  34. STING is a central mediator of interferon-regulated inflammasome activation during Chlamydia trachomatis infection. PMID: 28570638
  35. TRIF and STING interact directly, through their carboxy-terminal domains, to promote STING dimerization, intermembrane translocation, and signaling. PMID: 27631700
  36. This study concludes that the R71H-G230A-R293Q (HAQ) variant of TMEM173 is a null TMEM173 allele. PMID: 27927967
  37. Results show that resistance to HSV-1 in the trigeminal ganglia during acute infection is partly conferred by STING and IFN-alpha/beta signaling in both bone marrow-derived and -resident cells, which collaborate to support a robust HSV-1-specific CD8(+) T cell response. PMID: 27511736
  38. These results suggest that LSm14A, a protein involved in RNA processing, plays a significant role in antiviral innate and adaptive immune responses by modulating MITA (also known as STING) levels in a cell type-specific manner. PMID: 27183626
  39. STING and TRIF contribute to mouse sepsis, depending on the severity of the disease model. PMID: 27755506
  40. Data suggest that activation of either RIG-I/MAVS or STING pathways during acute intestinal tissue injury in mice resulted in IFN-I signaling that maintained gut epithelial barrier integrity and reduced graft-versus-host disease severity. PMID: 28424327
  41. This study demonstrates that iRhom2 is essential for STING activity, as it regulates TRAPbeta-mediated translocation and EIF3S5-mediated deubiquitination of STING. PMID: 27428826
  42. The mitochondrial damage-cGAS-STING-IRF3 pathway is critically involved in metabolic stress-induced endothelial inflammation. PMID: 28302626
  43. Data show that STING induces tumor cytotoxicity by NK cells through tumor and host immune cell network, contributing to innate surveillance and suppression of tumors in vivo. PMID: 27608599
  44. Results reveal a greater complexity in the role of STING signaling in cancer, underscoring how innate immune pathways in the tumor microenvironment modify tumorigenesis in distinct tumor settings. PMID: 26964621
  45. NLRX1 sequesters the DNA-sensing adaptor STING from interaction with TBK1, which is essential for IFN-1 induction in response to viral DNA. PMID: 27078069
  46. Sting protein plays a role in the innate immune response and interferon-stimulated genes response pathway. PMID: 26903602
  47. STING is required for chitosan-mediated enhancement of antigen-specific Th1 and immunoglobulin G2 responses following vaccination. PMID: 26944200
  48. In vitro activation of the AIM2 inflammasome in murine macrophages and dendritic cells leads to reduced activation of the STING pathway, partially through promoting caspase-1-dependent cell death. PMID: 26927800
  49. A STING-dependent, cGAS-independent pathway is important for full interferon production and antiviral control of enveloped RNA viruses. PMID: 26893169
  50. These data provide evidence that the N-terminal domain of STING affects DNA responses by controlling trafficking. PMID: 26685207

Show More

Hide All

Database Links
Protein Families
TMEM173 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Present in spleen and thymus tissue. Also present in dendritic cells (at protein level).

Q&A

What is the fundamental role of STING1 in mouse immune responses?

STING1 functions as a major regulator of the innate immune response to viral and bacterial infections. The protein is encoded by the Sting1 gene and operates as a pattern recognition receptor that detects cytosolic nucleic acids, subsequently transmitting signals that activate type I interferon responses. These interferon responses are critical for establishing antiviral states in cells . STING1 is a five-transmembrane protein that, upon binding of cyclic dinucleotides like c-di-GMP or cGAMP, undergoes oligomerization and translocation from the endoplasmic reticulum. TBK1 then phosphorylates STING1 on the pLxIS motif, leading to recruitment and activation of the transcription factor IRF3, which induces type I interferon expression . Beyond interferon production, STING1 also plays a direct role in autophagy processes, making it a multifunctional protein in immune regulation .

How do mouse models help elucidate human STING1 variant functions?

Mouse models with knock-ins of human STING1 variants provide valuable experimental systems for studying how these variants function in an in vivo context. Researchers have generated mice expressing common human STING1 alleles such as HAQ (R71H-G230A-R293Q), AQ (G230A-R293Q), and Q293, which are carried by significant portions of human populations—approximately 60% of East Asians carry HAQ alleles and about 40% of Africans carry AQ alleles . These mouse models allow researchers to investigate how these common alleles modulate immune responses and inflammatory conditions like STING-associated vasculopathy with onset in infancy (SAVI) . By comparing wild-type mice with those expressing human STING1 variants, researchers can identify critical residues and mechanisms involved in STING1 function. For example, studies using these models have established the crucial role of residue 293 in STING1-mediated cell death .

What are the key experimental considerations when working with recombinant mouse STING1?

When working with recombinant mouse STING1, several methodological considerations are essential:

ConsiderationRecommendationRationale
Cell type selectionUse type-specific cells for relevant resultsSTING1-mediated effects are highly cell-type dependent; different responses occur in T cells vs. myeloid cells
STING1 agonist choiceConsider membrane permeabilitySome agonists (cGAMP) require cell permeabilization, while others (diABZI, DMXAA) can directly cross membranes
Dose determinationPerform careful titration studiesDifferent doses can yield varying results; heterozygous HAQ and AQ splenocytes resist low-dose but not high-dose agonists
Species differencesAccount for mouse vs. human variationsResearch findings may not directly translate between species due to functional differences
Genetic backgroundConsider allelic variationsCommon STING1 alleles can significantly impact experimental outcomes

Proper controls and validation experiments are necessary to ensure reproducibility and relevance of results when working with recombinant STING1 protein .

How do common human STING1 alleles (HAQ, AQ, Q293) affect cell death mechanisms in experimental systems?

Research using knock-in mice expressing human STING1 variants has revealed that HAQ, AQ, and Q293 alleles significantly alter STING1-mediated cell death. The residue 293 of STING1 plays a critical role in this process, as splenocytes from mice expressing these variants show resistance to STING1-mediated cell death ex vivo .

Mechanistically, STING1-mediated cell death appears to be independent of type I interferons, which is particularly important for understanding therapeutic implications . Studies have demonstrated that WT/HAQ and WT/AQ heterozygous splenocytes are protected from cell death induced by 25 μg/ml of the STING1 agonist DMXAA, though higher concentrations (100 μg/ml) can still induce cell death, albeit less effectively than in WT/WT cells . This indicates that the HAQ and AQ alleles have a dominant effect and can impact STING1 activation even in heterozygosity.

Similarly, human primary cells from individuals with the WT/HAQ genotype show resistance to low-dose diABZI-induced cell death compared to WT/WT cells . These findings establish a critical molecular basis for understanding how common genetic variants influence STING1 function in diverse human populations.

What methodological approaches can distinguish between different cell death pathways activated by STING1?

Distinguishing between the multiple cell death pathways potentially activated by STING1 requires comprehensive methodological approaches:

  • Pathway-specific inhibitors: Researchers should employ specific inhibitors of apoptosis (e.g., Z-VAD-FMK), necroptosis (e.g., necrostatin-1), pyroptosis (e.g., VX-765), and ferroptosis (e.g., ferrostatin-1) to identify the predominant mechanism in their experimental system .

  • Genetic approaches: Utilize knockout or knockdown of key molecules in each death pathway (e.g., caspases for apoptosis, MLKL for necroptosis) to confirm pathway involvement.

  • Cell type consideration: STING1-mediated cell death manifests differently depending on cell type. While STING1 activation kills human endothelial cells and T cells, it does not kill mouse MEFs, BMDCs, or BMDMs . Human studies show that diABZI and RpRpss-Cyclic di-AMP kill human CD4 T cells but not CD8 T or CD19 B cells .

  • Species-specific variations: Researchers must account for differences between mouse and human systems, as the mechanisms and susceptibility to STING1-mediated death vary between species .

  • Morphological and biochemical assessment: Combine flow cytometry, microscopy, and biochemical assays to characterize cell death features and molecular markers specific to each pathway.

The complexity observed in STING1-mediated cell death likely stems from the variation in experimental systems, including different cell types and STING1 agonists used in studies .

How can researchers interpret CD4 T cellpenia in STING1-related disease models?

CD4 T cellpenia (reduced CD4 T cell numbers) is a significant feature observed in both SAVI patients and mouse models. Interpreting this phenomenon requires careful experimental design and analysis:

  • Phenotypic characterization: Comprehensive immunophenotyping should be performed, analyzing not just CD4 T cell numbers but also their subsets, particularly regulatory T cells (Tregs). Research has shown that HAQ/SAVI(N153S) and AQ/SAVI(N153S) mice have significantly more Tregs (~10-fold and ~20-fold, respectively) than WT/SAVI(N153S) mice .

  • Mechanistic evaluation: CD4 T cellpenia mechanisms should be assessed through both in vitro cell death assays and in vivo adoptive transfer studies. STING1 activation has been shown to kill CD4 T cells ex vivo, but the in vivo significance was unclear until studies with SAVI mice .

  • Comparative analysis: Researchers should compare findings between different STING1 genotypes. The HAQ/SAVI(N153S) and AQ/SAVI(N153S) mice do not develop CD4 T cellpenia, suggesting that these common alleles can rescue the SAVI phenotype .

  • Translational relevance: Interestingly, while SAVI mouse models show both CD4 and CD8 T cellpenia, human SAVI patients typically have normal CD8+ T cell numbers but reduced CD4+ T cells . Addressing this discrepancy is critical for understanding the translational relevance of mouse models.

Based on these studies, researchers have proposed that STING1 activation promotes tissue inflammation by depleting Tregs in vivo, providing a potential mechanism for SAVI pathogenesis and suggesting new therapeutic targets .

What are the key differences between mouse and human STING1 function that impact experimental design?

Significant differences exist between mouse and human STING1 function that researchers must consider:

FeatureMouse STING1Human STING1Experimental Implication
Cell death susceptibilityBoth CD4 and CD8 T cells affectedCD4 T cells more susceptible than CD8 T cellsCell type-specific readouts needed
Agonist responseDMXAA activates mouse but not human STING1Human STING1 has different agonist specificitySpecies-appropriate agonists must be used
Allelic variationLimited in lab strainsHighly variable with HAQ, AQ, etc. present in human populationsHuman STING1 knock-in mice provide better translational models
Disease manifestationSAVI mice show both CD4 and CD8 T cellpeniaSAVI patients have normal CD8+ T cells but reduced CD4+ T cellsDifferential interpretation of mouse findings required
Translational outcomesSTING1 agonists effective in mouse cancer modelsClinical trials with STING1 agonists have been disappointingPoor mouse-to-human transferability is a major issue

These differences explain why STING1 research has faced challenges in clinical translation. Researchers should consider using human STING1 knock-in mice (especially with common alleles like HAQ and AQ) to better model human responses . Additionally, validating findings in primary human cells is essential before making translational claims.

What experimental approaches are most effective for studying STING1 activation in T cell regulation?

Studying STING1 activation in T cell regulation requires specialized experimental approaches:

  • Knock-in mouse models: Utilize mice expressing human STING1 variants (HAQ, AQ, Q293) to study allele-specific effects. These models have revealed that HAQ/SAVI(N153S) and AQ/SAVI(N153S) mice have more Tregs than WT/SAVI(N153S) mice, suggesting allele-specific effects on T cell regulation .

  • Ex vivo cell death assays: Treat splenocytes or human primary cells with STING1 agonists (2'3'-cGAMP, RpRpss-Cyclic di-AMP, diABZI) and measure cell death by Propidium Iodide staining to assess STING1-mediated cell death in different T cell subsets .

  • Cell type-specific analysis: Separate analysis of CD4 T, CD8 T, and CD19 B cells is crucial as STING1-mediated effects are highly cell type-dependent. For instance, diABZI and RpRpss-Cyclic di-AMP kill human CD4 T but not CD8 T or CD19 B cells .

  • Dose titration: Carefully titrate STING1 agonists as different doses can yield varying results. WT/HAQ and WT/AQ splenocytes resist 25 μg/ml DMXAA-induced cell death but succumb to 100 μg/ml DMXAA .

  • Regulatory T cell assessment: Quantify Treg numbers and function in different STING1 genotypes, as the HAQ/SAVI(N153S) and AQ/SAVI(N153S) mice have significantly more Tregs than WT/SAVI(N153S) mice, which may explain their protection from inflammatory disease .

These approaches have led to the hypothesis that STING1 activation promotes tissue inflammation by depleting Tregs in vivo, which could guide future therapeutic strategies targeting the STING1 pathway .

How should STING1 allelic variation inform therapeutic applications and clinical trial design?

STING1 allelic variation has significant implications for therapeutic applications and clinical trial design:

  • Genotype-stratified trials: Clinical trials should stratify participants based on STING1 genotype (WT/WT, WT/HAQ, WT/AQ, etc.), as these variations significantly impact STING1 function. The HAQ allele is carried by approximately 60% of East Asians, while the AQ allele is present in about 40% of Africans .

  • Personalized dosing: WT/HAQ and WT/AQ individuals may require different dosing of STING1-targeting therapeutics. Ex vivo studies show that WT/HAQ and WT/AQ splenocytes resist low-dose but not high-dose STING1 agonists .

  • Efficacy predictions: The disappointing results from STING1 agonist-based clinical trials (NCT02675439, NCT03010176, NCT05514717) may be partly explained by inadequate consideration of participant STING1 genotypes .

  • Safety monitoring: Different STING1 alleles may influence the safety profile of STING1-targeting therapeutics. The AQ/SAVI mice show no tissue inflammation, regular body weight, and normal lifespan despite having comparable TBK1, IRF3, and NFκB activation as WT/SAVI mice .

  • Population-specific expectations: Therapeutic outcomes may vary among different populations due to the uneven distribution of STING1 alleles across human populations. Clinical trial design and analysis should account for these demographic differences .

The evidence strongly suggests that STING1 heterogeneity in humans should be a key consideration in both research and clinical applications of STING1-targeting immunotherapies .

What are the key considerations when developing experimental models for STING-associated vasculopathy (SAVI)?

Developing effective experimental models for STING-associated vasculopathy (SAVI) requires attention to several critical factors:

These models have already provided valuable insights, suggesting that STING1 activation promotes tissue inflammation by depleting T-regulatory cells in vivo, which may guide the development of new therapeutic approaches .

What techniques are most effective for detecting and measuring STING1 activation in experimental systems?

Effective detection and measurement of STING1 activation requires multiple complementary approaches:

  • Phosphorylation analysis: Monitor phosphorylation of TBK1 and IRF3, which are key downstream events following STING1 activation. Western blotting with phospho-specific antibodies can quantify these events .

  • Translocation assays: Track STING1 translocation from the endoplasmic reticulum following activation using immunofluorescence microscopy or subcellular fractionation techniques .

  • Interferon production: Measure type I interferon production using ELISA, qPCR, or reporter assays as a functional readout of STING1 activation .

  • Oligomerization detection: Assess STING1 oligomerization following ligand binding using native PAGE, crosslinking studies, or FRET-based approaches .

  • Cell death assessment: Quantify cell death as a STING1 activation outcome using flow cytometry with viability dyes such as Propidium Iodide staining. This is particularly relevant for studying STING1-mediated CD4 T cell death .

  • Pathway activation markers: Examine activation of NFκB pathway components alongside TBK1/IRF3 to get a complete picture of STING1 signaling outputs .

It's important to note that STING1-mediated cell death is independent of type I IFN production, so researchers should not rely solely on interferon readouts to assess STING1 function . Additionally, experimental readouts may vary depending on the cell type being studied, as STING1 effects are highly cell type-dependent .

How can researchers optimize experimental conditions for studying STING1-mediated cell death?

Optimizing experimental conditions for studying STING1-mediated cell death requires careful attention to multiple variables:

VariableOptimization StrategyJustification
Cell type selectionUse primary cells relevant to research questionSTING1 kills human endothelial cells and T cells but not mouse MEFs, BMDCs, or BMDMs
STING1 agonist choiceSelect appropriate to species and questioncGAMP requires permeabilization; diABZI and DMXAA directly cross membranes
Concentration titrationTest multiple doses in pilot experimentsWT/HAQ and WT/AQ cells resist 25 μg/ml but not 100 μg/ml DMXAA
TimingExamine multiple time points (6h, 12h, 24h)Cell death kinetics vary by cell type and activation method
Culture conditionsStandardize media, serum, cell densityThese factors can influence cell viability and STING1 responses
Death pathway inhibitorsInclude specific inhibitors in parallel experimentsHelps distinguish between apoptosis, necroptosis, pyroptosis, etc.
Genotype verificationConfirm STING1 genotype of experimental cellsHAQ, AQ alleles significantly alter STING1-mediated cell death

It's crucial to include appropriate controls, such as cells from animals with different STING1 genotypes (e.g., WT/WT, WT/HAQ, WT/AQ) to understand the impact of genetic variation . Additionally, researchers should consider validating key findings in both mouse and human systems, as there are important species differences in STING1 function .

What are the most reliable protocols for generating and validating STING1 knock-in mouse models?

Generating and validating STING1 knock-in mouse models requires rigorous protocols to ensure model fidelity and research reproducibility:

  • Targeting vector design:

    • Include the desired mutation in the mouse Sting1 gene or introduce the human STING1 variant

    • Incorporate selection markers (e.g., neo gene) flanked by recombination sites (e.g., FRT)

    • Include sufficient homology arms for efficient recombination

  • Embryonic stem cell targeting:

    • Transfect linearized targeting vector into C57BL/6N embryonic stem cells

    • Select positive clones using appropriate antibiotics

    • Verify correct targeting by PCR and sequencing

  • Chimera generation:

    • Inject targeted ES cells into C57BL/6J blastocysts

    • Transfer to pseudopregnant females

    • Identify chimeric offspring by coat color

  • Germline transmission verification:

    • Breed chimeric mice to confirm germline transmission

    • Use PCR sequencing to confirm the presence of the desired mutation

  • Selection marker removal:

    • Breed heterozygous mice to transgenic mice expressing appropriate recombinase (e.g., Actin-flpase mice to remove neo gene using FRT sites)

    • Verify marker removal by PCR

  • Validation procedures:

    • Confirm expression of the mutant protein by Western blotting

    • Verify functional changes using ex vivo assays (e.g., STING1 agonist-induced cell death in splenocytes)

    • Characterize phenotypic features relevant to the research question (e.g., CD4 T cell numbers in SAVI models)

  • Experimental controls:

    • Use age- and gender-matched mice (2-6 months old, both male and female)

    • Randomly assign littermates of the same sex to experimental groups

    • Perform treatments blindly where possible to prevent bias

These protocols have been successfully used to generate HAQ, AQ, and Q293 knock-in mice, which have provided valuable insights into STING1 function and its role in inflammatory diseases .

What are the emerging research questions regarding STING1 function in autoimmunity and cancer immunotherapy?

The field of STING1 research is evolving rapidly, with several key emerging questions:

  • Allele-specific therapeutic responses: How do common STING1 alleles (HAQ, AQ) influence responses to STING1-targeting cancer immunotherapies? The disappointing results from clinical trials may be partly explained by inadequate consideration of participant STING1 genotypes .

  • Regulatory T cell mechanisms: What is the precise mechanism by which STING1 activation depletes regulatory T cells in vivo? Understanding this process could provide new therapeutic targets for both autoimmune conditions and cancer .

  • Cell death pathway determination: Which of the multiple proposed cell death mechanisms (apoptosis, necroptosis, pyroptosis, ferroptosis, PANoptosis) is most relevant in different pathological contexts? This remains unclear despite extensive research .

  • Species-specific differences: How can we better account for the differences between mouse and human STING1 function to improve translational research? The poor transferability of mouse findings to humans has been a significant issue .

  • Personalized medicine applications: How should STING1 genotyping be incorporated into clinical decision-making for inflammatory diseases and cancer immunotherapy? Billions of humans carry the dominant HAQ and AQ alleles, which could significantly impact treatment outcomes .

  • Non-canonical functions: Beyond interferon induction and cell death, what other cellular processes does STING1 regulate? Research has already identified roles in autophagy, but additional functions may exist .

These questions highlight the importance of considering STING1 heterogeneity in humans for both research and clinical applications of STING1-targeting therapeutics .

How might tissue-specific STING1 functions inform therapeutic development strategies?

Understanding tissue-specific STING1 functions is crucial for developing targeted therapeutic strategies:

  • T cell compartment: STING1 activation differentially affects CD4 vs. CD8 T cells, with CD4 T cells being more susceptible to STING1-mediated cell death in humans. Therapeutic approaches may need to account for these differences, particularly in conditions where T cell preservation is desired .

  • Regulatory T cell preservation: HAQ/SAVI(N153S) and AQ/SAVI(N153S) mice have significantly more Tregs than WT/SAVI(N153S) mice. This suggests that modulating STING1 activity to preserve Tregs could be beneficial in inflammatory conditions .

  • Cell type-specific targeting: STING1 activation kills human endothelial cells and T cells but not mouse MEFs, BMDCs, or BMDMs. Developing delivery systems that target specific cell populations could enhance therapeutic efficacy while reducing off-target effects .

  • Tissue microenvironment considerations: Local tissue factors may influence STING1 signaling outcomes. Studies comparing different tissues may reveal important context-dependent effects that could be therapeutically relevant .

  • Genetic background integration: Therapeutic development should consider how different STING1 alleles function in specific tissues. The WT/HAQ genotype is the most common in East Asians (~34.3%), while WT/AQ is the second most common in Africans (~28.2%), suggesting population-specific therapeutic considerations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.