Recombinant Mouse Transmembrane protein 176A (Tmem176a)

Shipped with Ice Packs
In Stock

Description

Immune System Modulation

  • Dendritic Cell Maturation: Tmem176a interacts with Tmem176b to regulate MHC class II antigen presentation. Knockdown studies show impaired dendritic cell maturation and reduced CD80/CD86 expression .

  • T Cell Priming: Germline double-knockout (DKO) mice reveal that Tmem176a/b is essential for optimal naive CD4+ T cell activation .

Cancer Biology

  • Non-Small Cell Lung Cancer (NSCLC): TMEM176A is upregulated in NSCLC tissues (p < 0.001). Silencing via RNAi inhibits cell proliferation, induces G0/G1 arrest, and promotes apoptosis by downregulating CDK4/Cyclin D1 and activating caspase-3 .

Immune Studies

  • Knockout Models: Tmem176a/b DKO mice show no developmental defects but exhibit impaired MHC II trafficking in dendritic cells .

  • Colocalization: Tmem176a/b localizes to late endolysosomal vesicles, overlapping with HLA-DM, suggesting a role in antigen processing .

Cancer Studies

  • Functional Impact: In NSCLC cells (A549, 95D), TMEM176A silencing reduces colony formation by 60–70% (p < 0.001) and increases apoptosis 3-fold .

Quality Control and Validation

  • Endotoxin Levels: <1.0 EU/μg (LAL method) .

  • Stability: Stable for 12 months at -80°C .

Future Directions

Current research gaps include:

  • Structural resolution of Tmem176a/b ion channel activity.

  • Therapeutic targeting in autoimmune diseases and cancer.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Tmem176a; Gs188; Keg2; Transmembrane protein 176A; Gene signature 188; Kidney-expressed gene 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem176a
Target Protein Sequence
MSTDMETAVVGKVDPEAPQPTHIDVHIHQESALAKLLLAGCSLLRIPASASTQSQGSSRV LVASWVVQTVLGALSVVLGGTLYIGHYLAMYSEGAPFWTGIVAMLAGAVAFLHKKRGGTC WALMRTLLVLASFCTAVAAIVIGSRELNFYWYFLGDDVCQRDSSYGWSTMPRTTPVPEEA DRIALCIYYTSMLKTLLMSLQAMLLGIWVLLLLASLTPVCVYIWKRFFTKAETEEKKLLG AAVI
Uniprot No.

Target Background

Database Links

KEGG: mmu:66058

UniGene: Mm.27061

Protein Families
TMEM176 family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in lung, kidney and spleen.

Q&A

What is Tmem176a and how is it related to Tmem176b?

Tmem176a is a four-span transmembrane protein that functions as an acid-sensitive, non-selective cation channel. It shares significant homology with Tmem176b, and both proteins appear to have redundant functions in many cellular contexts. These homologous genes encode proteins that are often co-expressed and work together in various cellular processes, particularly within the immune system . Experimental approaches targeting either protein alone may yield incomplete results due to their functional redundancy, suggesting that double knockout models are more appropriate for studying their physiological roles.

Where is Tmem176a primarily expressed in mice?

Tmem176a shows strong expression in myeloid cells and the retinoic acid-related orphan receptor (ROR)γt+ lymphoid cell family, also referred to as type 3 (or type 17) immune cells. These include Th17 CD4+ T cells, γδT17 cells, group 3 innate lymphoid cells (ILC3s), and NKT17 cells . Notably, Tmem176a has been identified among a restricted group of just 11 genes whose expression is directly dependent on RORγt in Th17 cells . Within dendritic cells, Tmem176a/b accumulate in dynamic post-Golgi vesicles that are preferentially linked to the late endolysosomal system and strongly colocalize with HLA-DM .

What is the subcellular localization of Tmem176a protein?

Tmem176a is predominantly located in intracellular compartments rather than the plasma membrane. Real-time imaging methods have demonstrated that Tmem176a accumulates in dynamic post-Golgi vesicles that are preferentially linked to the late endolysosomal system . Within dendritic cells, Tmem176a strongly colocalizes with HLA-DM in the MHC II compartment (MIIC), suggesting its direct role in antigen presentation . This intracellular localization aligns with its function in regulating ion fluxes within specific cellular compartments involved in immune response coordination.

What are the most effective knockout strategies for studying Tmem176a function?

Due to the functional redundancy between Tmem176a and Tmem176b, single knockout strategies often yield limited phenotypic results. The most effective approach involves creating conditional double knockout (DKO) mice targeting both genes simultaneously. This can be achieved by generating mice with floxed alleles for both Tmem176a and Tmem176b (Tmem176a/b^fl), which can then be crossed with tissue-specific Cre recombinase-expressing mouse lines . For embryonic stem cell modifications, C57BL/6N genetic background is commonly used with LoxP sites inserted on both sides of Tmem176a and Tmem176b genes . This approach allows for tissue-specific deletion of both genes while avoiding potential developmental compensation mechanisms.

How can recombinant Tmem176a protein be produced and purified for in vitro studies?

Recombinant mouse Tmem176a protein can be expressed in mammalian cell systems to ensure proper folding and post-translational modifications. The protein can be tagged (commonly with a His-tag) to facilitate purification through affinity chromatography . The purified protein is typically stored in PBS buffer and maintained at -20°C to -80°C for long-term storage or at +4°C for short-term use . Protein purity can be assessed using SDS-PAGE followed by Coomassie staining, with successful preparations typically achieving >80% purity . When designing experiments, researchers should consider whether full-length or partial protein constructs are most appropriate for their specific research questions.

What detection methods are most reliable for studying Tmem176a expression in tissue samples?

For protein-level detection, immunohistochemistry or immunofluorescence using validated antibodies against Tmem176a is effective. Fluorometric techniques using antibodies conjugated with fluorescent dyes (such as IRDye 800CW) can provide quantitative measurements when normalized to housekeeping proteins like β-actin . For mRNA detection, quantitative RT-PCR remains the gold standard, though RNA-seq approaches offer broader contextual information. When analyzing tissue microarrays or histological samples, it's important to include proper controls and normalize protein levels against stable reference proteins to account for tissue-specific variations in expression .

How does Tmem176a influence dendritic cell function in antigen presentation?

Tmem176a and its homolog Tmem176b are required in conventional dendritic cells (cDCs) for optimal antigen processing and presentation to CD4+ T cells . These ion channels play a direct role in the MHC II compartment (MIIC) for the fine regulation of antigen presentation and naive CD4+ T cell priming . Mechanistically, they allow cation (Na+) counterflux required for progressive endophagosomal acidification, which is essential for antigen cross-presentation . RNAi-induced knockdown of mouse Tmem176a and Tmem176b in immature bone marrow-derived dendritic cells (BMDCs) suppresses the production of co-stimulatory molecules such as CD-80, CD86, and CD40, which prevents the activation of specific T cells in culture .

What is the functional relationship between Tmem176a and MHC class II antigen presentation?

Tmem176a localizes to the MHC II compartment (MIIC) and strongly colocalizes with HLA-DM, a key facilitator of peptide loading onto MHC class II molecules . This spatial association suggests that Tmem176a regulates the ionic environment within the MIIC, which is critical for optimal peptide loading and subsequent antigen presentation. Interestingly, while RNAi-induced knockdown of Tmem176a/b suppresses the production of co-stimulatory molecules, some studies have not reported significant changes in the levels of MHC-II proteins . This apparent contradiction with other observations (where overexpression of rat Tmem176b in BMDCs results in reduction of MHC-II) suggests that the relationship between these ion channels and MHC-II expression may be complex and context-dependent.

How do Tmem176a and Tmem176b contribute to immune tolerance mechanisms?

Tmem176a/b contribute to the suppressive function of ex vivo-generated tolerogenic dendritic cells through antigen cross-presentation mechanisms . Their negative effects on the activation and maturation of immature conventional dendritic cells (cDCs) suggest a role in maintaining immune tolerance . The regulation of endophagosomal acidification through cation counterflux may be one mechanism by which these channels influence the tolerogenic capacity of dendritic cells . Understanding these mechanisms is particularly relevant for developing strategies to modulate immune responses in contexts such as autoimmunity, transplantation, and cancer immunotherapy.

What is the evidence linking Tmem176a to cancer development and progression?

TMEM176A has been implicated in cancer pathology through several mechanisms. In human lung cancer, TMEM176A is frequently methylated, and this methylation regulates its expression . When TMEM176A expression is restored in cancer cells, it induces cell apoptosis and G2/M phase arrest while inhibiting colony formation, cell proliferation, migration, and invasion . In xenograft models, TMEM176A suppressed H1299 lung cancer cell growth in mice . Interestingly, human TMEM176A and 176B protein levels are significantly elevated in lymphoma but not in normal tissues , suggesting context-dependent roles in different cancer types. These findings indicate that TMEM176A may function as a tumor suppressor in certain cancers, particularly lung cancer.

How might targeting Tmem176a be therapeutically relevant for cancer treatment?

Methylation of TMEM176A has been identified as a potential synthetic lethal therapeutic marker for AZD0156, an ATM kinase inhibitor . Specifically, methylation of TMEM176A sensitized H1299 and H23 lung cancer cells to AZD0156, while re-expression of TMEM176A reduced the sensitivity of these cells to this inhibitor . This suggests that TMEM176A methylation status could serve as a biomarker for predicting response to certain targeted therapies. Additionally, given that TMEM176A can suppress tumor growth, strategies to restore its expression in cancers where it is silenced by methylation could potentially have therapeutic value. Understanding the mechanisms by which TMEM176A influences cancer cell survival and proliferation may reveal new therapeutic targets.

What inflammatory or autoimmune diseases have been associated with Tmem176a dysregulation?

Transcriptomic, single-nucleotide polymorphism, and epigenetic analyses have associated Tmem176a with multiple inflammatory and autoimmune conditions including multiple sclerosis, chronic obstructive pulmonary disease, and age-related macular degeneration . These associations suggest an important role of Tmem176a in regulating inflammatory responses, possibly through its effects on dendritic cell function and subsequent T cell activation. The precise mechanisms by which Tmem176a dysregulation contributes to these conditions remain to be fully elucidated, representing an important area for future research.

How do Tmem176a ion channel properties contribute to its cellular functions?

Tmem176a functions as an acid-sensitive, non-selective cation channel . This property allows it to regulate ion fluxes within intracellular compartments, particularly those involved in antigen processing and presentation. In dendritic cells, Tmem176a contributes to endophagosomal acidification by allowing cation (Na+) counterflux . This ion transport activity is critical for creating the appropriate ionic environment within vesicular compartments for optimal protein processing and peptide loading. The acid sensitivity of the channel suggests that its activity may be regulated by pH changes within these compartments, potentially providing a feedback mechanism that fine-tunes antigen processing and presentation.

What signaling pathways does Tmem176a interact with or influence?

Methylation of TMEM176A has been shown to activate ERK signaling in lung cancer cells . Given that ERK signaling is a central pathway controlling cell proliferation, survival, and differentiation, this interaction may explain some of the tumor-suppressive effects of TMEM176A. Additionally, the functional relationships between Tmem176a and immune cell activation suggest potential interactions with signaling pathways downstream of pattern recognition receptors and cytokine receptors, though these connections remain to be fully characterized. Further research is needed to comprehensively map the signaling networks influenced by Tmem176a in different cellular contexts.

What is known about the post-translational modifications of Tmem176a?

While specific information about post-translational modifications of Tmem176a is limited in the provided search results, the regulation of TMEM176A by promoter methylation in cancer cells has been well-documented . This epigenetic regulation affects protein expression levels rather than representing a direct post-translational modification of the protein itself. Given that Tmem176a functions as an ion channel and localizes to specific intracellular compartments, it likely undergoes various post-translational modifications that influence its trafficking, stability, and activity. Further research using mass spectrometry-based approaches would be valuable for identifying these modifications and understanding their functional significance.

What are the optimal storage and handling conditions for recombinant Tmem176a protein?

Recombinant mouse Tmem176a protein is typically stored in PBS buffer, with specific conditions dependent on intended use duration. For short-term storage, +4°C is generally sufficient, while long-term storage requires -20°C to -80°C to maintain protein integrity and activity . When working with the protein, it's advisable to minimize freeze-thaw cycles as these can lead to protein denaturation and activity loss. The endotoxin level should be maintained below 1.0 EU per μg of protein as determined by the LAL method to prevent confounding effects in biological assays .

What expression systems yield the highest quality recombinant Tmem176a for functional studies?

Mammalian cell expression systems are typically preferred for producing recombinant Tmem176a protein, as they provide the appropriate cellular machinery for proper folding and post-translational modifications of this multi-pass transmembrane protein . These systems more closely replicate the native conformation of the protein compared to bacterial expression systems. For functional studies that depend on proper protein folding and activity, it's particularly important to use mammalian-derived recombinant protein. The addition of affinity tags (such as His tags) facilitates purification while generally maintaining protein function, though researchers should verify that the tag doesn't interfere with the specific activity being studied .

How can researchers effectively validate the activity of recombinant Tmem176a in experimental systems?

Validating recombinant Tmem176a activity requires assays that assess its ion channel function and biological effects. For ion channel activity, patch-clamp electrophysiology or fluorescent ion flux assays can be employed. Biological activity can be assessed by measuring the protein's effects on dendritic cell function, including antigen presentation capacity and expression of co-stimulatory molecules. Additionally, researchers can evaluate the protein's subcellular localization using fluorescently-tagged constructs to confirm proper trafficking to post-Golgi vesicles and the late endolysosomal system . When possible, complementation experiments in Tmem176a-deficient cells provide strong evidence for the recombinant protein's functional activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.