Recombinant Mouse Transmembrane protein 176B (Tmem176b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Tmem176b; Clast1; Lr8; Transmembrane protein 176B; Protein LR8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem176b
Target Protein Sequence
MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKKFLSWPQARIHYGQLS LGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAGVGTIVHEKRQGKLSGQ VSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPLQSSMDPGYGTVRYSDDS DWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGLSLRSMYGRSSQALNEEES ERKLLDGHPAPASPAKEKIPAIL
Uniprot No.

Target Background

Function
Tmem176b plays a crucial role in dendritic cell maturation and is essential for the development of cerebellar granule cells.
Gene References Into Functions
  1. A study characterized the expression of Tmem176a and b in RORgamma t+ lymphocytes at both transcriptional and protein levels. This study provides evidence that both genes have a redundant ion channel function, indicating their colocalization in close proximity to the Golgi apparatus. PMID: 27009467
  2. Tmem176b induces the differentiation of myoblasts into the osteoblast lineage. PMID: 24085390
  3. Data indicates the downregulation of Clast1/LR8 as a potentially critical mechanism by which oncogenic Ras-mediated neoplastic transformation occurs. PMID: 20550525
  4. These data suggest that Tmem176B and Tmem176A associate to form multimers and restrain dendritic cell maturation. PMID: 20501748
  5. The Clast1 gene is ubiquitously expressed in various organs of adult mice and is required for the development of cerebellar granule cells. PMID: 16814752

Show More

Hide All

Database Links
Protein Families
TMEM176 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed with higher expression in lung, liver, kidney and colon. Expressed in cerebellar granule cells.

Q&A

What is the molecular structure and function of Tmem176b?

Tmem176b is an intracellular, acid-sensitive, non-specific cation channel that belongs to the membrane-spanning 4A (MS4A) protein family. It shares approximately 30% identity with TMEM176A, another member of the MS4A family . Functionally, Tmem176b serves as an ion channel predominantly localized in endophagosomal membranes where pH is tightly regulated .

The protein is encoded by the Tmem176b gene (also known as Clast1, Lr8, or 1810009M01Rik), which produces multiple transcript variants. Transcript variant 3 (NM_001164209) has been well-characterized and is available as a Myc-DDK-tagged expression-ready ORF plasmid for research applications .

Methodology for structural studies: To investigate Tmem176b structure, researchers typically employ:

  • Protein crystallography or cryo-electron microscopy

  • Computational modeling based on homology with other MS4A family members

  • Electrophysiological characterization to analyze channel properties

What are the expression patterns of Tmem176b in mouse tissues?

Tmem176b exhibits widespread expression across multiple mouse tissues, with particularly high levels detected in:

Tissue/Cell TypeRelative ExpressionNotes
Primary lymphoid organsHighBone marrow, thymus
Secondary lymphoid organsHighSpleen, lymph nodes
ColonHigh-
LungHighAssociated with adenocarcinoma progression
LiverHigh-
Myeloid cellsVery highDendritic cells, macrophages
RORγT+ cellsModerate to highILC3, Th17, and γδ T cells

Methodology for expression analysis:

  • Quantitative RT-PCR for transcript quantification

  • Immunohistochemistry or immunofluorescence for tissue localization

  • Single-cell RNA sequencing for cell-specific expression profiles

  • Flow cytometry with validated antibodies for protein quantification

How does Tmem176b function in the immune system?

Tmem176b has emerged as a dual regulator of immune responses, with context-dependent effects that can either promote or inhibit immunity . This duality makes it a particularly interesting target for immunotherapeutic approaches.

Immunoregulatory RoleMechanismEvidence
Inhibition of effector immune responsesModulates ion homeostasis in immune cellsAssociated with immunological tolerance in transplantation models
High expression in tumor infiltrate correlates with poor survival in colon cancer
Associated with resistance to immune checkpoint blockers in melanoma
Promotion of immune responsesSupports antigen presentationRequired for optimal dendritic cell function in certain contexts
Associates with clinical responses to anti-TNF therapy in rheumatoid arthritis

Methodology for functional analysis:

  • Knockout and overexpression models to assess cellular phenotypes

  • Dendritic cell maturation assays measuring surface markers (MHC-II, CD40, CD80, CD86)

  • Mixed lymphocyte reaction assays to measure T cell stimulatory capacity

  • In vivo disease models (cancer, autoimmunity, transplantation)

How does Tmem176b contribute to cancer progression?

Recent research has uncovered important roles for Tmem176b in promoting cancer development and progression, particularly in lung adenocarcinoma .

Cancer TypeRole of Tmem176bMolecular MechanismClinical Significance
Lung adenocarcinomaPromotes EMT and tumor growthActivates FGFR/JNK signaling pathwayOverexpression associated with poor prognosis
Colon cancerSuppresses anti-tumor immunityInhibition of effector immune responsesHigh expression in tumor infiltrate correlates with poor survival
MelanomaContributes to immunotherapy resistanceUnknownExpression associated with resistance to immune checkpoint blockers

Methodology for cancer research:

  • Stable cell lines with Tmem176b overexpression or knockdown

  • Migration and invasion assays to assess metastatic potential

  • EMT marker analysis (E-cadherin, N-cadherin, Vimentin, Snail)

  • Phosphorylation status of FGFR1/JNK pathway components by Western blotting

  • Orthotopic xenograft models to evaluate tumor growth and metastasis in vivo

  • Co-immunoprecipitation to identify signaling pathway interactions

What approaches can be used to model Tmem176b function in experimental systems?

Experimental ApproachApplicationsConsiderations
CRISPR-Cas9 knockoutLoss-of-function studiesTarget conserved exons encoding transmembrane domains
Consider compensatory upregulation of Tmem176a
Conditional knockout (Cre-loxP)Tissue-specific functionEssential for studying context-dependent roles
Expression vectorsGain-of-function studiespCMV6-Entry vector with C-terminal tags is commonly used
Pharmacological modulatorsAcute modulation of channel activityLimited specific inhibitors currently available
Patient-derived modelsClinical relevanceImportant for validating findings from cell lines

Methodology for genetic manipulation:

  • Gene editing with precise CRISPR-Cas9 targeting

  • Inducible expression systems for temporal control

  • Validation by quantitative RT-PCR and Western blotting

  • Functional verification of channel activity alterations

How can researchers investigate the role of Tmem176b in dendritic cell biology?

Tmem176b plays a critical role in dendritic cell (DC) maturation and function, with complex effects depending on the experimental context .

DC TypeEffect of Tmem176bExperimental Approaches
Mouse BMDCsRegulates basal expression of MHC class II and CD86Flow cytometry for maturation markers
Down-regulated by LPS or poly I:C treatmentCytokine profiling
Human MoDCsExpression down-regulated by TNF plus poly I:CAllostimulatory capacity assessment
Rat splenic DCsDown-regulated by CD40LAntigen presentation assays

Methodology for DC research:

  • Differentiation of bone marrow-derived DCs or monocyte-derived DCs

  • Stimulation with various maturation stimuli (LPS, poly I:C, CD40L)

  • Flow cytometric analysis of maturation markers

  • Mixed lymphocyte reactions to measure T cell stimulatory capacity

  • Cytokine secretion profiling by ELISA or multiplex assays

What is the relationship between Tmem176b and the epithelial-mesenchymal transition (EMT) in cancer?

The role of Tmem176b in promoting EMT, particularly in lung adenocarcinoma, represents an emerging area of research with important implications for understanding cancer metastasis .

EMT AspectTmem176b InvolvementSignaling Pathways
Cell invasion and migrationEnhanced by Tmem176b overexpressionFGFR1/JNK signaling cascade
EMT marker expressionRegulates Vimentin/SnailJNK-dependent activation
AngiogenesisEnhances tube formation of endothelial cellsUnknown mechanisms
Tumor growth in vivoPromoted by Tmem176bFGFR1/JNK pathway

Methodology for EMT research:

  • Wound healing and transwell migration/invasion assays

  • Immunoblotting for EMT markers (E-cadherin, Vimentin, Snail)

  • Pathway inhibition studies using FGFR and JNK inhibitors

  • Tube formation assays with endothelial cells

  • Xenograft models with Tmem176b-modified cancer cells

How does the genetic variation in Tmem176b affect its function in different disease contexts?

Several genetic variants of Tmem176b have been identified with potential disease relevance :

Genetic VariantDisease AssociationFunctional Implication
A134TMultiple sclerosis susceptibilityPotential gain or loss of channel function
Favorable prognosis in colorectal cancerContext-dependent effects
Other polymorphismsUnder investigationMay affect ion channel properties or protein interactions

Methodology for genetic studies:

  • Targeted sequencing or genotyping assays

  • Structure-function analysis of variant proteins

  • Electrophysiological comparison of wild-type and variant channels

  • Population genetics approaches to assess variant frequencies

  • Clinical correlation studies in patient cohorts

How can researchers differentiate between Tmem176b and Tmem176a functions?

Given the 30% sequence identity between Tmem176b and Tmem176a, distinguishing their specific functions requires careful experimental design :

ApproachApplicationTechnical Considerations
Isoform-specific antibodiesProtein detectionValidate specificity against both isoforms
Gene-specific siRNA/shRNAKnockdown studiesTest for cross-reactivity
Single and double knockout modelsIn vivo functional studiesAssess compensatory mechanisms
Selective overexpressionGain-of-function studiesUse optimized expression vectors like pCMV6-Entry

Methodology for isoform specificity:

  • Western blotting with validated antibodies

  • qPCR with primers targeting divergent regions

  • Rescue experiments in knockout backgrounds

  • Comparative expression profiling across tissues

What are the optimal approaches for studying Tmem176b in the FGFR/JNK signaling pathway?

The involvement of Tmem176b in the FGFR/JNK signaling pathway, particularly in cancer contexts, requires specialized technical approaches :

TechniqueApplicationKey Considerations
Phospho-specific immunoblottingPathway activationAnalyze FGFR1, JNK, and downstream targets
Co-immunoprecipitationProtein interactionsIdentify direct binding partners
Pathway inhibitorsFunctional validationUse selective FGFR and JNK inhibitors
ProteomicsGlobal pathway impactCompare Tmem176b-overexpressing and knockdown samples

Methodology for signaling pathway analysis:

  • Western blotting for phosphorylated FGFR1, JNK, and Vimentin

  • Inhibitor studies using titrated concentrations of pathway blockers

  • Co-immunoprecipitation followed by mass spectrometry

  • Reporter gene assays for pathway activation

How should researchers interpret contradictory findings regarding Tmem176b function?

The dual and context-dependent roles of Tmem176b can lead to apparently contradictory experimental results. Resolving these contradictions requires careful consideration of:

FactorImpact on Tmem176b FunctionResearch Approach
Cellular contextDifferent effects in different cell typesUse multiple cell types and primary cells
MicroenvironmentInfluence of surrounding cells and factorsConsider 3D culture or co-culture systems
Ion channel vs. signaling rolesDistinct functions based on mechanismSeparate channel function from protein interactions
Genetic backgroundModifier genes may alter phenotypesUse consistent genetic backgrounds

Methodology for resolving contradictions:

  • Parallel experiments in multiple model systems

  • Careful attention to experimental conditions

  • Comprehensive phenotyping in knockout models

  • Integration of in vitro and in vivo findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.