Recombinant Mouse Transmembrane protein 178 (Tmem178)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem178a; Tmem178; Transmembrane protein 178A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-297
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem178a
Target Protein Sequence
IFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGRRLLPGGPGRS DPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYH FSQPIRLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESL TQHVAGLLFLMTGIFCTISLCTYAASVSYDLNRVPKLIYSLPHDVEHGYSWSIFCAWCSL GFIVAAGGLCIAYPFISRTKIAHLKSGRDSTV
Uniprot No.

Target Background

Function
This protein acts as a negative regulator of osteoclast differentiation under basal and inflammatory conditions. It achieves this by modulating TNFSF11-induced Ca2+ fluxes, thereby controlling NFATC1 induction.
Gene References Into Functions
  1. Tmem178, localized to the ER membrane, regulates RANKL-induced Ca2+ fluxes and consequently controls NFATc1 induction. PMID: 26644563
Database Links
Protein Families
TMEM178 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the bone and its expression increases during osteoclastogenesis.

Q&A

What is Tmem178 and what are its key cellular functions?

Tmem178 is a transmembrane protein that functions as a critical modulator of the NFATc1 (Nuclear factor of activated T-cells, cytoplasmic 1) signaling axis. It acts within a negative feedback loop downstream of Phospholipase C gamma-2 (PLCγ2) to regulate calcium signaling in myeloid lineage cells. The protein plays an essential role in maintaining skeletal mass and limiting pathological bone loss by suppressing osteoclast differentiation .

In contrast to the osteopetrotic phenotype observed in PLCγ2-deficient mice, Tmem178-null mice display reduced bone mass, indicating that Tmem178 serves as a negative regulator within the PLCγ2 pathway. This function positions Tmem178 as part of an unexpected negative feedback mechanism that restrains excessive osteoclastogenesis . Beyond bone metabolism, Tmem178 also negatively regulates IL-1β production through inhibition of NLRP3 inflammasome activation, suggesting a broader role in controlling inflammatory responses .

Where is Tmem178 primarily expressed and how is it regulated?

Tmem178 shows significant expression in cells of myeloid lineage, particularly in osteoclast precursors. Its expression increases progressively during osteoclastogenesis and depends on PLCγ2 signaling . Human CD14+ monocytes demonstrate a similar pattern of Tmem178 induction when treated with RANKL compared to M-CSF alone .

The regulation of Tmem178 expression involves multiple transcription factors. The Tmem178 promoter contains NFAT consensus binding sites, and studies with NFATc1-deficient cells show blunted RANKL-induced Tmem178 upregulation, confirming that NFATc1 is required for Tmem178 expression . Additionally, Tmem178 expression is induced by cellular adhesion, a process that partially depends on the classical NF-κB subunit p65. These findings position Tmem178 directly downstream of the RANKL/PLCγ2 axis in osteoclasts, creating a critical regulatory loop that modulates osteoclast differentiation .

How does Tmem178 regulate calcium signaling in osteoclasts?

Tmem178 is a transmembrane protein localized to the endoplasmic reticulum (ER) membrane where it plays a crucial role in regulating calcium mobilization. Through immunofluorescence studies, researchers have determined that Tmem178 resides in the ER but not in the plasma membrane of mature osteoclasts . At the molecular level, Tmem178 interacts with Stim1, an ER calcium sensor that controls calcium fluxes during osteoclastogenesis .

The interaction between Tmem178 and Stim1 occurs primarily under resting conditions and diminishes in the presence of thapsigargin (Tg) and extracellular calcium. Importantly, Tmem178 does not interact with Orai1 (a plasma membrane calcium channel) nor does it affect the coupling between Stim1 and Orai1 . This selective interaction suggests that Tmem178 binds to Stim1 independent of store-operated calcium entry (SOCE), establishing a unique mechanism for regulating calcium homeostasis in osteoclast precursors.

What is the relationship between Tmem178 and NFATc1 in bone metabolism?

Tmem178 functions as a negative regulator of NFATc1, a master transcription factor essential for osteoclast differentiation. In Tmem178-deficient cells, there is an increase in calcium fluxes that leads to amplified NFATc1 levels . This is evidenced by heightened NFATc1 transcript levels throughout osteoclastogenesis in Tmem178-/- cultures, along with a higher percentage of cells displaying NFATc1 nuclear staining .

The absence of Tmem178 results in earlier and greater magnitude of induction of NFATc1 target genes, including TRAP (Acp5), Cathepsin K (CtsK), and calcitonin receptor (Calcr) . Cytoplasmic and nuclear fractionation experiments demonstrate earlier and sustained NFATc1 nuclear translocation in Tmem178-/- osteoclasts compared to wild-type cells . Conversely, ectopic expression of Tmem178 in wild-type bone marrow macrophages (BMMs) attenuates NFATc1 transcripts, reduces NFATc1 nuclear translocation in response to RANKL, and subsequently diminishes osteoclastogenesis . These findings firmly establish Tmem178 as a critical component of a negative feedback loop that restrains excessive NFATc1 activation and osteoclast differentiation.

What bone phenotype do Tmem178-deficient mice exhibit?

Contrary to the expected osteopetrotic phenotype similar to PLCγ2-/- mice, 16-week-old female Tmem178-/- mice display a 35% decrease in trabecular bone volume with significant trabecular thinning compared to wild-type littermates . Tartrate-resistant acid phosphatase (TRAP) staining of long bone sections reveals a significant increase in osteoclast surface normalized to bone surface in Tmem178-/- mice .

The bone phenotype appears to be osteoclast-specific, as osteoblast numbers remain equivalent between genotypes . Supporting this observation, mineral apposition rate (MAR), bone formation rate (BFR), and RANKL and OPG mRNA levels in whole bones flushed of marrow cells are similar in both wild-type and Tmem178-/- mice . These in vivo data suggest that Tmem178 specifically suppresses osteoclast differentiation via an unexpected negative feedback loop downstream of PLCγ2, without affecting osteoblast function.

How does Tmem178 deficiency affect inflammatory bone loss?

Tmem178-deficient mice are highly susceptible to inflammatory bone loss. In vitro studies demonstrate that the addition of TNF-α or LPS further exacerbates osteoclast differentiation in Tmem178-/- cultures . When challenged with LPS injections over the calvaria, Tmem178-/- mice develop profound focal osteolysis and increased osteoclast surface compared to wild-type controls .

How does Tmem178 regulate the NLRP3 inflammasome and IL-1β production?

Tmem178 functions as a negative regulator of NLRP3 inflammasome activation and subsequent IL-1β production. Following stimulation with TLR ligands like LPS or CpG, Tmem178-/- mice exhibit significantly increased IL-1β levels in serum, peritoneal fluid, and liver lysates compared to wild-type animals . This enhanced IL-1β production is mediated through increased NLRP3 inflammasome activation rather than differences in NF-κB signaling .

Mechanistically, Tmem178 controls NLRP3 inflammasome activation via store-operated calcium entry (SOCE). When Stim1 (a critical component of SOCE) is knocked down, the increased percentage of caspase-1 positive cells and IL-1β release observed in Tmem178-/- bone marrow-derived macrophages (BMDMs) is significantly reduced . Importantly, expression of wild-type Tmem178, but not a Tmem178 mutant lacking the Stim1 binding site, can rescue the enhanced inflammasome activation in Tmem178-/- BMDMs . These results indicate that the direct interaction between Stim1 and Tmem178 is required to suppress NLRP3 activation.

What is the relationship between Tmem178 and mitochondrial dysfunction?

Tmem178 deficiency leads to increased mitochondrial reactive oxygen species (mtROS) production, which contributes to enhanced NLRP3 inflammasome activation. Treatment with the SOCE inhibitor 2-Aminoethoxydiphenyl borate (2-APB) significantly reduces mtROS levels in Tmem178-/- cells but not in wild-type cells . This finding indicates that loss of Tmem178 activates SOCE, which in turn induces mitochondrial damage and mtROS production—events that ultimately lead to NLRP3 inflammasome activation .

The connection between Tmem178 and mitochondrial function represents an important link between calcium homeostasis and inflammatory responses. By regulating calcium signaling through its interaction with Stim1, Tmem178 helps maintain mitochondrial integrity and prevents excessive inflammasome activation during inflammatory challenges.

What are effective methods for studying Tmem178-Stim1 interaction?

To investigate the interaction between Tmem178 and Stim1, researchers have employed several complementary approaches. Co-immunoprecipitation experiments are particularly useful, where Tmem178-HA and Stim1-Myc are co-expressed in HEK293T cells, followed by immunoprecipitation and western blotting . This method has revealed that Tmem178 and Stim1 interact under resting conditions, with reduced interaction in the presence of thapsigargin (Tg) and extracellular calcium .

Confocal microscopy provides another valuable approach for visualizing the Tmem178-Stim1 interaction in more physiologically relevant contexts. By performing immunofluorescence staining in bone marrow macrophages (BMMs) treated with RANKL for 24 hours, researchers have confirmed the Tmem178-Stim1 interaction . For functional studies, researchers have generated a Tmem178 mutant (Tmem178-L212W;M216W) that lacks the Stim1 binding site . Expression of this mutant in Tmem178-/- cells fails to rescue the enhanced inflammasome activation, unlike wild-type Tmem178 expression, highlighting the importance of this interaction .

How can researchers measure calcium flux in relation to Tmem178 function?

Calcium flux studies are essential for understanding Tmem178 function. Researchers typically employ calcium-sensitive fluorescent dyes in conjunction with live-cell imaging or flow cytometry to measure intracellular calcium levels in real-time. When comparing wild-type and Tmem178-deficient cells, it's important to consider both basal calcium levels and dynamic changes following stimulation.

To specifically assess the role of SOCE in Tmem178-mediated calcium regulation, experiments can be performed in calcium-free media followed by calcium re-addition. Pharmacological agents like thapsigargin (to deplete ER calcium stores) and 2-APB (to inhibit SOCE) are valuable tools in these studies . Additionally, manipulating extracellular calcium levels or using calcium chelators like BAPTA can help determine the calcium-dependency of observed phenotypes . These approaches have revealed that Tmem178 deficiency leads to increased intracellular calcium levels in myeloid cells, contributing to enhanced inflammasome activation and osteoclastogenesis.

What are the discrepancies in phenotypes between PLCγ2-/- and Tmem178-/- mice?

One of the most intriguing aspects of Tmem178 biology is the contrasting phenotypes observed between PLCγ2-deficient and Tmem178-deficient mice. While PLCγ2-/- mice exhibit an osteopetrotic phenotype (increased bone mass), Tmem178-/- mice display osteopenia (decreased bone mass) . This apparent paradox arises from the position of Tmem178 as a downstream target of PLCγ2 that functions in a negative feedback loop.

The molecular basis for this discrepancy lies in the role of Tmem178 as a negative regulator of calcium signaling and NFATc1 activation. In PLCγ2-/- mice, the initial calcium signaling required for osteoclastogenesis is impaired, preventing osteoclast formation and leading to increased bone mass . In contrast, Tmem178-/- mice have intact PLCγ2 signaling but lack the negative feedback mechanism provided by Tmem178, resulting in enhanced calcium signaling, increased NFATc1 activation, and excessive osteoclast differentiation that leads to bone loss . This relationship highlights the complexity of calcium-dependent signaling networks in bone homeostasis and emphasizes the importance of negative regulatory mechanisms in fine-tuning cellular responses.

What is the relevance of Tmem178 to human inflammatory diseases?

Reduced Tmem178 expression correlates with inflammatory conditions in humans, suggesting its potential relevance as a biomarker and therapeutic target. Studies have shown that Tmem178 expression is significantly reduced in human CD14+ monocytes exposed to plasma from systemic juvenile idiopathic arthritis (sJIA) patients . Similar to the mouse model, this reduced Tmem178 expression in human cells correlates with excessive osteoclastogenesis .

The connection between Tmem178 and Stim1 is particularly interesting in the context of arthritis. Stim1 single nucleotide polymorphisms (SNPs) have been identified in patients with ankylosing spondylitis (AS), a chronic inflammatory disease of the spine and joints . These SNPs correlated with significantly higher inflammatory markers including C-reactive protein and in some cases higher circulating levels of TNF-α and IL-6 . Furthermore, Tmem178-deficient mice suffer profound osteolysis following LPS administration and in the K/BxN arthritis model, supporting a role for Tmem178 in restraining inflammatory bone loss .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.