Recombinant Mouse Transmembrane protein 191C (Tmem191c)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem191c; MNCb-4137; Transmembrane protein 191C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-121
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem191c
Target Protein Sequence
MEAAAALEATRGGSEPWNSEPRPVQDCAGSLMEEVARADCEKRLFGGTGAGSLRLWALSA LQTLLLLPLGFLVLPLIYVVLAKPDAVGPGLQSLGSDAVFRRLRYTLSPLLELRARGLLP A
Uniprot No.

Target Background

Database Links

KEGG: mmu:224019

UniGene: Mm.246388

Protein Families
TMEM191 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Mouse Transmembrane protein 191C and what are its alternative designations?

Mouse Transmembrane protein 191C (Tmem191c) is a membrane-spanning protein with several alternative gene names in scientific literature, including MNCb-4137, D16Bwg1494e, and 4933405M22Rik . The protein is part of the broader transmembrane protein family, which are characterized by domains that span the cell membrane. For research purposes, recombinant forms of this protein are commonly used to study its structure, function, and biological interactions. When designing experiments involving Tmem191c, researchers should be aware of these alternative designations to ensure comprehensive literature searches.

What expression systems are typically used for producing recombinant Tmem191c?

Recombinant Mouse Tmem191c can be produced using multiple expression systems, with each offering distinct advantages depending on research requirements:

Expression SystemAdvantagesConsiderationsTypical Purity
E. coliCost-effective, high yield, rapid expressionLimited post-translational modifications≥85% by SDS-PAGE
YeastSome post-translational modifications, high yieldDifferent glycosylation patterns than mammalian cells≥85% by SDS-PAGE
BaculovirusMore complex post-translational modificationsHigher cost, longer production time≥85% by SDS-PAGE
Mammalian CellNative-like post-translational modificationsHighest cost, lower yield, complex protocols≥85% by SDS-PAGE
Cell-Free ExpressionRapid, avoids cell toxicity issuesLimited scale, higher cost per unit protein≥85% by SDS-PAGE

The choice of expression system should be determined by your specific experimental needs, particularly if post-translational modifications are critical to your research questions.

What methods are recommended for verifying the purity and identity of recombinant Tmem191c?

For comprehensive validation of recombinant Tmem191c, researchers should employ multiple complementary techniques:

  • SDS-PAGE: Standard for assessing purity, with recombinant Tmem191c preparations typically achieving ≥85% purity

  • Western Blotting: Using specific antibodies such as T191C rabbit polyclonal antibodies for detection and verification

  • Mass Spectrometry: For precise molecular weight determination and protein sequence confirmation

  • ELISA: Can be used for quantitative detection of the protein in various research contexts

When publishing research, inclusion of these validation steps is essential for ensuring reproducibility and reliability of findings.

How should I design experiments to study Tmem191c function in cellular systems?

When designing experiments to investigate Tmem191c function, implement a systematic approach:

  • Define clear variables: Identify independent variables (e.g., Tmem191c expression levels, stimulation conditions) and dependent variables (e.g., cellular responses, protein interactions)

  • Develop testable hypotheses: Formulate specific predictions about Tmem191c function based on literature and preliminary data

  • Include appropriate controls:

    • Negative controls (e.g., cells without Tmem191c expression)

    • Positive controls (e.g., cells expressing a well-characterized transmembrane protein)

    • Vehicle controls for any treatments

  • Consider experimental design type:

    • Between-subjects design: Different experimental units for each condition

    • Within-subjects design: Same experimental units across multiple conditions

For rigorous investigation of membrane protein function like Tmem191c, combining multiple methodological approaches (e.g., overexpression, knockout, mutation analysis) provides more robust insights than single-approach studies.

What are the recommended approaches for studying species-specific differences in Tmem191c function?

When investigating species-specific aspects of Tmem191c function, consider these methodological approaches:

  • Comparative sequence analysis: Align human TMEM191C and mouse Tmem191c sequences to identify conserved and divergent regions

  • Cross-species functional assays: Perform parallel experiments in both mouse and human cell lines to identify differential responses

  • Domain-swapping experiments: Create chimeric proteins containing domains from both species to pinpoint regions responsible for functional differences

  • Transcriptional profiling: Analyze differential gene expression patterns induced by Tmem191c in different species using RNASeq or similar approaches

Research has demonstrated that even closely related proteins can exhibit significant species-specific differences in function, transport, metabolism, and cellular response profiles . For example, studies of other transmembrane proteins have shown that rat and human renal cell lines can display differential toxicity responses that correlate with distinct changes in gene expression patterns .

What experimental controls are essential when working with recombinant Tmem191c in cellular systems?

Robust controls are critical for meaningful Tmem191c research:

Control TypePurposeImplementation
Expression ControlVerify Tmem191c expressionWestern blot with anti-Tmem191c antibody
Negative ControlEstablish baselineMock-transfected cells or expression vector without Tmem191c
Subcellular Localization ControlConfirm proper membrane localizationCo-localization with known membrane markers
Functional ControlValidate activity assaysWell-characterized transmembrane protein with similar properties
Specificity ControlConfirm antibody specificityPre-absorption with recombinant protein or peptide competition
Loading ControlEnsure equal sample loadingHousekeeping proteins (β-actin, GAPDH) for Western blots

These controls help distinguish between Tmem191c-specific effects and experimental artifacts, enhancing reproducibility and result interpretation.

How can I investigate the role of Tmem191c in tissue-specific contexts?

For tissue-specific investigation of Tmem191c:

  • Conditional knockout models: Use tissue-specific promoters driving Cre recombinase in floxed Tmem191c mouse models

  • Ex vivo tissue approaches: Isolate primary tissues from different organs to compare expression and function

  • Organoid systems: Develop 3D organoid cultures expressing Tmem191c at varying levels

  • Tissue-specific transcriptomics: Perform RNA-Seq across multiple tissues to identify co-expressed gene networks

Recent research methodologies emphasize the importance of studying membrane proteins like Tmem191c in physiologically relevant contexts that maintain tissue architecture and cellular interactions. Unlike traditional 2D cell culture, these approaches better recapitulate the in vivo microenvironment.

What are recommended approaches for studying potential post-translational modifications of Tmem191c?

Post-translational modifications (PTMs) can significantly impact transmembrane protein function:

  • Mass spectrometry-based approaches:

    • Phosphoproteomics for phosphorylation sites

    • Glycoproteomics for glycosylation patterns

    • Global PTM analysis for comprehensive modification mapping

  • Site-directed mutagenesis:

    • Systematically mutate predicted modification sites

    • Assess functional consequences through cellular assays

  • Expression system selection:

    • Compare Tmem191c expressed in different systems (bacterial, yeast, insect, and mammalian)

    • Evaluate functional differences that may indicate important PTMs

When comparing results between different expression systems, researchers should be aware that differences in PTM machinery may lead to functionally distinct protein products despite identical primary sequences.

How can transcriptomic approaches enhance understanding of Tmem191c function?

RNA-Seq and other transcriptomic methods provide powerful insights into Tmem191c biology:

  • Differential expression analysis following Tmem191c manipulation:

    • Overexpression vs. control

    • Knockout/knockdown vs. control

    • Mutation of functional domains vs. wild-type

  • Gene set enrichment analysis (GSEA):

    • Identify pathways and biological processes affected by Tmem191c modulation

    • Connect Tmem191c to broader cellular functions

  • Comparative transcriptomics:

    • Compare responses across different cell types and species

    • Identify conserved and divergent gene networks

In one study examining other transmembrane proteins, GSEA revealed that despite chemical- and cell-dependent effects, common pathways related to extracellular matrix turnover, coagulation cascade, and adrenal cortex response were enriched across multiple experimental conditions . Similar approaches could uncover conserved functions of Tmem191c.

What strategies can overcome solubility and stability challenges when working with recombinant Tmem191c?

Membrane proteins like Tmem191c present specific handling challenges:

  • Buffer optimization:

    • Screen different buffer compositions (pH, salt concentration, additives)

    • Consider inclusion of mild detergents or lipid nanodiscs for stability

  • Storage condition optimization:

    • Short-term: 4°C storage with preservatives (e.g., 0.02% Proclin 300)

    • Long-term: Small aliquots at -20°C to minimize freeze-thaw cycles

  • Fusion tag strategies:

    • Consider Fc-fusion approaches for improved half-life and solubility

    • Evaluate His-tag, GST, or MBP fusions for enhanced solubility

  • Quality control monitoring:

    • Implement routine SDS-PAGE analysis to assess protein integrity over time

    • Monitor functional activity using established assays at regular intervals

Researchers have found that fusion proteins combining transmembrane proteins with stable domains like Fc can significantly improve in vivo and in vitro solubility and stability .

How should researchers address the challenge of species differences when translating mouse Tmem191c findings?

Translational research with Tmem191c requires careful consideration of species differences:

  • Comparative structural analysis:

    • Align mouse Tmem191c and human TMEM191C sequences

    • Identify conserved functional domains and divergent regions

  • Parallel validation experiments:

    • Test hypotheses simultaneously in mouse and human systems

    • Use paired cell lines from both species (e.g., mouse and human renal cells)

  • Consideration of species-specific factors:

    • Different enzyme activities and metabolic pathways between species

    • Variations in protein expression levels and tissue distribution

    • Species differences in interacting protein partners

Previous research with other proteins has demonstrated significant species-specific differences in toxicity, metabolism, and response profiles between rodent and human cells, emphasizing the importance of cross-species validation . For example, studies showed that differential toxicity between rat and human renal cell lines was mediated by distinct gene expression changes .

What are recommended troubleshooting approaches for inconsistent results in Tmem191c assays?

When encountering variability in Tmem191c experimental results:

  • Protein quality assessment:

    • Verify protein purity via SDS-PAGE (target ≥85%)

    • Confirm identity via Western blot with specific antibodies

    • Assess batch-to-batch consistency

  • Experimental variables audit:

    • Cell passage number and density

    • Reagent quality and storage conditions

    • Equipment calibration and performance

  • Protocol standardization:

    • Implement detailed standard operating procedures (SOPs)

    • Control timing of experimental steps precisely

    • Standardize data collection methods

  • Systematic validation:

    • Reproduce key findings using alternative techniques

    • Test in multiple cell lines or experimental systems

    • Consider blinded experimental design and analysis

Maintaining consistent experimental conditions is particularly important for transmembrane protein research, as these proteins are sensitive to changes in membrane composition, cell culture conditions, and handling procedures.

What statistical approaches are most appropriate for analyzing Tmem191c functional data?

Appropriate statistical analysis is crucial for robust Tmem191c research:

  • For basic characterization:

    • Descriptive statistics (mean, standard deviation, standard error)

    • Confidence intervals for measurements of protein properties

  • For comparative experiments:

    • t-tests for two-group comparisons

    • ANOVA with appropriate post-hoc tests for multi-group comparisons

    • Consider non-parametric alternatives if data violates normality assumptions

  • For complex experimental designs:

    • Mixed-effects models for nested or repeated measures designs

    • Multiple regression for analyzing relationships between variables

    • ANCOVA when controlling for covariates

  • For high-dimensional data:

    • Appropriate multiple testing correction (e.g., Benjamini-Hochberg)

    • Dimension reduction techniques (PCA, t-SNE) for visualization

    • Specialized methods for RNA-Seq or proteomics data

Statistical planning should be an integral part of experimental design, not an afterthought, as it ensures sufficient power to detect biologically meaningful effects .

How can researchers integrate multi-omics data to better understand Tmem191c function?

Multi-omics integration provides comprehensive insights into Tmem191c biology:

  • Data collection across platforms:

    • Transcriptomics: RNA-Seq to identify genes affected by Tmem191c manipulation

    • Proteomics: Mass spectrometry to identify interacting partners

    • Metabolomics: Identify metabolic pathways influenced by Tmem191c

    • Epigenomics: Determine if Tmem191c affects chromatin state

  • Integrative analysis approaches:

    • Pathway enrichment across multiple data types

    • Network analysis to identify functional modules

    • Multi-omics factor analysis (MOFA) for dimension reduction

    • Correlation analysis between different data types

  • Validation of key findings:

    • Select critical nodes from integrative analysis

    • Validate experimentally using targeted approaches

    • Develop mechanistic models based on integrated findings

Multi-omics approaches have proven valuable in understanding complex biological systems and can reveal unexpected connections between Tmem191c and cellular processes that might be missed by single-omics approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.